2599 Websites:Organisations:Summaries:Related categories:Related keywords:Related locations:
osheasrotterdam.nl123goldThis website features various organizations and topics, including recruitment, a themed day, jewelry, and skincare products.Family Activities → Day Trips 419 Entertainment → Leisure Activities 338 diamond 198 shampoo 258 recruitment 2015 De Fryske Marren → Terherne 98
arnoudvanderidder.nlGaasterlandThe website for Gaasterland provides information about the area, including nature, history, events, and attractions, with a focus on the activities of public historian Arnoud van de Ridder.Nature → Nature Lodges 32 history 7286 nature 9094 event 45199 De Fryske Marren → Oudemirdum 73
bobshypotheken.nlBob RijkhoffThe website Bobs hypotheken provides independent mortgage advice tailored to individuals in the West Friesland region.Property Sales → Selling Property 37 Financial Services → Advice 1003 financial situation 181 mortgage 4564 insurance 6359 home 7976 appointment 13510 Medemblik → Wognum 185
meestermakelaars.nlMeester MakelaarsMeester Makelaars is a real estate agent that helps individuals buy or sell houses in West-Friesland.Real Estate → Immobilien 284 Context 161394 agent 1253 purchase 2212 region 5412 sale 5930 house 8121 appointment 13510 De Fryske Marren → Lemmer 1188
limousineservicefriesland.nlLimousine Service FrieslandThe website, Limousine Service Friesland, offers limousine rental services in the province of Friesland and surrounding areas, specializing in long limousines and various luxury vehicles with drivers.Personal Transportation → Limousines 71 limousine 117 luxury 375 driver 1832 rental 7257 Northeast-Friesland → Dokkum 846
lunchroommem.nlLunchroom MemLunchroom Mem is a lunchroom and learning/workplace in Joure, Netherlands, with a B&B, focused on creating a welcoming atmosphere and offering support to participants in the work process.Bars → Pubs 546 Hotels → Boutique Hotels 914 father 94 lunchroom 312 mother 603 b&b 1060 guest 1334 De Fryske Marren → Joure 689
ontstoppingsbedrijf-hoogeveen.nlRioolprobleemkwijt.nlThe website of Hoogeveen Unblocking Company offers a professional and 24-hour unblocking service in the Hoogeveen region and surrounding areas.Waste Management → Sewer Cleaning 66 Technical Services → Technical 957 toilet 467 drain 886 drainage 1322 De Fryske Marren → Echten 54
mollenhoop.nlMollema FamilyThe website of the Mollema family offers a glimpse into the lives of the Mollema family, with an emphasis on their mole activities and personal stories.Law → Family 2909 Land Development & Earthworks → Earthmoving 643 mole 61 earth 108 family 6462 photo 7778 story 8285 Amsterdam → Sloten 146
bnbinhetcentrumvanenkhuizen.nlBNB In het centrum van EnkhuizenThe website of BNB In het centrum van Enkhuizen offers two accommodations – a studio and an apartment – in a historic house located in the center of the historic town of Enkhuizen, catering to guests looking for a stay in the region.Context 161394 west-friesland 41 accommodation 4921 apartment 5088 studio 5465 De Fryske Marren → Lemmer 1188
kotaradja-beilen.nlRolf BenzThe website showcases a selection of furniture and interior products, as well as advice on gardening design and interior styling.Living & Dining → Sofas 540 Decor & Furnishings → Home Stores 932 coat rack 23 interior design advice 129 sofa 481 garden 13129 Midden-Drenthe → Beilen 498
nicoreus.nlNico Reus installatietechniekNico Reus installatietechniek is an installation company specializing in the replacement of boilers.Heating → Boilers 336 Home Improvement → Heating Systems 604 installer 677 boiler 1240 De Fryske Marren → Lemmer 1188
frisianumismatica.nlFrisia NumismaticaFrisia Numismatica is an online shop and sales platform specializing in coins, banknotes, gold, and silver, with a particular focus on Dutch and historical coins.Collectibles → Coins 43 Collectibles → Coin Collection 16 tokens 29 banknote 36 coin 313 gold 805 jewelry 4599 collection 7566 The Hague → Haagse Hout 347
westfrieslandopglasvezel.nlDelta Fiber NetwerkThis website informs business owners in West-Friesland about the rollout of business fiber internet via the Delta Fiber network, in collaboration with Blue ICT Advies. The goal is to inform potential customers and encourage registrations for the rollout.Radio & Communication → Networks 341 Business → Industry 36977 rollout 35 fiber 167 internet 1678 collaboration 16036 De Fryske Marren → Lemmer 1188
electrotechniekzwaan.nlElectrotechniek ZwaanElectrotechniek Zwaan is an electrician based in Andijk providing a range of electrical services.Lighting & Electrical → Utilities 388 Energy → Electricity 712 electrician 819 electrical 1414 installation 13742 repair 14576 maintenance 20093 Medemblik → Andijk 242
lanen-rietbuurt.nlLanen & Rietbuurt Neighbourhood Watch TeamThe website of the Lanen & Rietbuurt Neighbourhood Watch Team describes the activities of a volunteer organization that improves the safety and livability of the Lanen and Rietbuurt neighborhoods by serving as an extra link between residents and the police and municipality.Neighborhood Focus → Neighborhoods 1028 Government & Administration → Law Enforcement 55 patrol 25 police 480 neighborhood 2424 volunteer 8367 De Fryske Marren → Oosterzee 29
winterkuier.nlStichting Lemster Dickens FestijnThe website of the Lemster Winterkuier presents information about the first edition of this event, including dates, route, times and ticket information.Hiking → Walking Routes 226 Seasonal & Weather → Winter Events 131 ticket 2785 route 3425 drink 5191 performance 7586 event 45199 De Fryske Marren → Lemmer 1188
swandesign.nlSwan DesignSwan Design is an online shop selling handmade jewelry, cushions, and other accessories.Upholstery & Fabrics → Cushions 245 Bedding → Blankets 69 cushion 823 jewelry 4599 webshop 8648 accessories 12975 Southwest-Friesland → Stavoren 155
cyberquestgame.nlCyberQuestGameThe CyberQuestGame website presents the results of an internet game in the form of a treasure hunt, where teams score points and win prizes. The aim is likely to promote this game and share the winning teams and their performance.Games → Online Games 639 Competitions → Team Competitions 18 championship 210 points 612 task 1507 game 2807 Altena → Sleeuwijk 162
regiohockey.nlREGIOHOCKEYREGIOHOCKEY is an initiative focused on providing indoor hockey clinics for youth in the North Holland region.Sport Organization → Hockey 550 hockey 348 exercises 1058 clinic 1079 trainer 1966 youth 3126 region 5412 Bloemendaal → Overveen 414
ruijtergroenservice.nlRuijter GroenserviceRuijter Groenservice is a gardening company that provides gardening maintenance, design, and landscaping services in the region of North Holland and West Friesland.Garden Maintenance → Tree Care 660 Outdoor & Garden → Garden Shops 795 landscaping 1529 garden 13129 maintenance 20093 design 27202 De Fryske Marren → Lemmer 1188
postmakraanverhuur.nlObe Postma KraanverhuurObe Postma Kraanverhuur is a groundworks specialist based in Sint Nicolaasga that rents out earthmoving equipment.Exterior Works → Excavation 316 crane 662 groundwork 1348 equipment 4143 report 4551 De Fryske Marren → Sint Nicolaasga 146
elanfysio.nlElan Fysio JoureElan Fysio Joure is a physiotherapy practice in Joure that uses a holistic approach to restore the body's balance and promote sustainable recovery.Physical Therapy → Osteopathy 922 shoulder 120 holistic 699 healing 1148 body 3490 physiotherapy 4688 complaint 6479 De Fryske Marren → Joure 689
beautyenderma.nlBeauty & Derma de HaskeThe website of Beauty & Derma de Haske is a skincare specialist with locations in Heerenveen, Oudehaske, and Joure, offering a wide range of skin improvement treatments, cosmetic procedures, and advice on healthy lifestyles.Skincare → Skin Treatment 166 Mental & Emotional Well-Being → Healthy Living 402 bioslimming 16 skin problems 220 skin improvement 1058 health 6366 treatment 21203 De Fryske Marren → Joure 689
chiptuning-feno.nlChiptuning FenoThe website Chiptuning Feno, located in Joure (Friesland), offers chiptuning services for almost all car brands, with a focus on improving vehicle performance through software adjustments.Automotive Maintenance → Chiptuning 229 Agriculture → Agricultural Machinery & Equipment 631 test bench 18 chiptuning 264 engine 758 software 8291 car 10865 brand 17737 De Fryske Marren → Joure 689
dejongyachtcharter.nlDe Jong SloepverhuurDe Jong Sloepverhuur is a sloop rental company located in Friesland that rents sloops without a boating license or deposit.Water Recreation → Sloop Rental 14 TravelBrands → Travel Agencies 1840 friesian lakes 12 sloop 272 fleet 1351 De Fryske Marren → Joure 689
dedrumboet.nlDrumschool de DrumboetDrumschool de Drumboet is a drum school located in Hoogkarspel, West-Friesland, offering drum lessons to beginners through advanced students of all ages.Percussion → Drums 111 Music Education → Drum Lessons 100 drum lesson 120 band 2977 instructor 3126 practice 9089 music 13170 event 45199 De Fryske Marren → Lemmer 1188
juwelierariedekoning.nlJuwelier Arie de KoningJuwelier Arie de Koning is a jeweler and online store located in Joure, Friesland, offering watches, jewelry, and baby items.Hobbies → Timepieces 48 baby items 75 watch 1166 jewelry 4599 repair 14576 De Fryske Marren → Joure 689
vanderwal-aanhangwagens.nlVan der Wal Aanhangwagens and Horse TrailersVan der Wal Aanhangwagens and Horse Trailers offers a range of trailers and related services, including sales, trade-in, rental, parts, and repairs.Trailers & Towing → Towing 16 Trailers & Towing → Trailers 650 horse trailer 82 trailer 1624 part 5044 transport 6105 rental 7257 repair 14576 De Fryske Marren → Oosterzee 29
autoservice-dejouwer.nlAutoservice de JouwerAutoservice de Jouwer is a car service company located in Joure that focuses on providing quality car maintenance and repairs to individuals and business drivers.Car Care & Detailing → Accessories 17 dealership 292 inspection 4279 repair 14576 maintenance 20093 De Fryske Marren → Joure 689
bedrijfsuitjeharlingen.nlBedrijfsuitje HarlingenThe website bedrijfsuitjeharlingen.nl offers a selection of 70 different corporate outings in and around Harlingen, aimed at team building and staff outings.Family Activities → Outings 763 Corporate Events → Corporate Outings 878 city game 81 team outing 221 corporate outing 388 outing 982 hospitality 3491 restaurant 11215 Northeast-Friesland → Dokkum 846
bedrijfsuitjeurk.nlStadsarrangementBedrijfsuitje Urk is a website offering a wide range of team outings and corporate outings in and around the city of Urk.Family Activities → Outings 763 Corporate Events → Corporate Outings 878 outing 982 city 1875 hospitality 3491 De Fryske Marren → Lemmer 1188
betongroep.nlFinish Beton GroepFinish Beton Groep specializes in the pouring and finishing of fiber reinforced concrete floors, the installation of bunkers (Sleufsilo's), and the trade in concrete-related products.Concrete & Cement → Concrete Products 55 Building & Materials → Concrete Structures 268 concrete products 15 bunker 92 fiber 167 concrete floor 184 concrete 973 De Fryske Marren → Sint Nicolaasga 146
boxzpark.nlBoxzPark B.V.The website of BoxzPark provides information about the rental and sale of multifunctional units in various locations in the Netherlands.Property Sales → Buying a House 872 Office Space → Rental Space 537 unit 405 purchase 2212 rental 7257 De Fryske Marren → Lemmer 1188
buisboekhoudburo.nlBoekhoudBuro BuisBoekhoudBuro Buis in Lemmer provides administrative and tax services to individuals, startups, and established businesses.Finance → Taxation 1567 Government & Legal → Tax 1322 business administration 96 startup 376 tax returns 423 payroll 1823 administration 6587 De Fryske Marren → Lemmer 1188
chalethureninfriesland.nlChalet Maison BlueThe website offers chalet and stacaravan rentals in Friesland, specifically in the Warns area near the Ijsselmeer.Camping → Farm Camping 386 Camping → Family Camping 50 chalet 1264 swimming pool 1664 camp 2466 Southwest-Friesland → Workum 363
deopblaasbarezeilboot.nlAquacrafts B.V.The website DinghyGo is an online platform focused on the sale and promotion of inflatable sailboats.Sailing → Sailboats 29 AccommodationTypes → Outdoors 224 sailboat 148 adventure 919 video 6714 De Fryske Marren → Lemmer 1188
douwekamminga.nlDouwe KammingaThis website provides information about Dutch musician Douwe Kamminga, including his biography, performance schedule, and a list of his music.Performance → Dutch Musicians 73 Festivals → Regional Festivals 82 party 5928 performance 7586 music 13170 event 45199 Opsterland → Tijnje 46
hait.nlHisse Akkerman InstallatietechniekHisse Akkerman Installatietechniek is an installation company specializing in residential and commercial installations, with a focus on Remeha CV boilers.Heating → Boilers 336 Installation & Mounting → Installation Contractors 56 boiler 1240 job 2795 energy 9075 installation 13742 De Fryske Marren → Lemmer 1188
halfzwaar.nlHalfzwaarThe website is a personal showcase of creative projects and 3D models, primarily focused on Lego, Arduino, and other repurposed materials.Electronics & Components → Arduino 19 Software Development & Engineering → Game Development 287 blender 56 arduino 123 3d-print 124 lego 341 De Fryske Marren → Joure 689
hoveniersbedrijfweerman.nlHoveniersbedrijf Sander WeermanThis website provides information about the services offered by Hoveniersbedrijf Weerman, including landscaping, garden maintenance, and paving, as well as project examples and contact details.Garden → Paving 1003 Exterior Works → Excavation 316 ceramic tiles 20 garden maintenance 462 landscaping 1529 paving 1942 De Fryske Marren →  Sintjohannesga 24
jdv-lasbedrijf.nlJDV LasbedrijfJDV Lasbedrijf is a welding company offering various welding services, including repairs and construction, and operating in Friesland and Groningen.Manufacturing → Metals & Fabrication 1224 certificate 1036 welding 1051 ship 5103 construction 7421 Northeast-Friesland → Dokkum 846
ooteman-elektro.nlOoteman ElektroThe website of Ooteman Elektro is a professional service provider for electrical adaptation and renovation, focused on private and business clients in the West Friesland region.Technology → Smart Home & Automation 1146 distribution box 41 home battery 517 electrician 819 solar panels 4701 region 5412 installation 13742 De Fryske Marren → Lemmer 1188
pizzeria-grillroom-cappadocia-joure.nlPizzeria & Grillroom CappadociaPizzeria & Grillroom Cappadocia is an online restaurant in Joure where customers can order food and place online orders.Food Delivery → Italian Restaurant 1040 Turkish Cuisine → Fast Food 3222 combo meal 65 lahmacun 93 kapsalon 509 sandwich 4098 pizza 4158 De Fryske Marren → Joure 689
gezinsklik.nlGezinsklik B.V.The website Gezinsklik is a family-friendly starting page with an extensive collection of tips and useful websites for the whole family.Blogs → Startpages 394 Family Fun → Family Activities 1493 page 427 banner 518 topic 1238 tips 2789 Rotterdam → Hoek van Holland 540
zoeken-online.nlVermelding.NLZoeken-Online is a comprehensive directory providing an overview of businesses and links to relevant websites.Office & Workspace → Business Directories 421 category 2316 vacation 4234 registration 4366 news 15293 De Fryske Marren → Lemmer 1188
hollandsail.nlHolland SailHolland Sail offers sailing vacations and sailing trips in the Netherlands, focusing on traditional ships and various water areas.Sailing → Sailing Schools 70 sail 965 trip 2032 water 2501 vacation 4234 ship 5103 Friesland → IJsselmeer 593
kinderopvangwestfriesland.nlStichting Kinderopvang West-FrieslandStichting Kinderopvang West-Friesland is an organization that provides childcare services in the West-Friesland region.Childcare → After-School Care 765 toddler 189 child center 196 cost 1990 childcare 3512 vacancy 6598 De Fryske Marren → Lemmer 1188
siebesail.nlSiebesailThe website, siebesail, offers free start pages and provides sailing courses.Southeast Asia → Vietnam 23 Water Sports → Sailing 1501 startpage 82 sailboat 148 sail 965 course 14728 De Fryske Marren → Goingarijp 86
airporttaxi247.nl24/7 Voordelig Van En Naar Ieder VliegveldThe website provides 24/7 airport taxi services, including nationwide coverage and online booking options.Flights → Airports 338 Taxi & Ride Services → Taxi 1062 coverage 348 airport 789 taxi 2090 book 11396 Oisterwijk → Haaren 255
omroepmax.nlOmroep MAXThe website of Omroep MAX is a platform for members to support the MAX channel and participate in various activities.Periodical Publications → Magazines 1001 TravelBrands → Tour Operators 363 max 18 outing 982 travel 7210 membership 10442 Vijfheerenlanden → Leerdam 672
socialdeal.nlSocial DealThe website, Social Deal, offers discounted deals and activities in local cities.TravelBrands → Deals 349 TravelBrands → Discounts 52 voucher 279 friend 639 deals 1070 arrangement 3104 region 5412 The Hague → Scheveningen 1625
paxx.nlPAXX B.V.The website of Paxx describes a platform that provides access to mobility services for elderly, sick, and disabled individuals via various apps.Social Issues → Inclusion 604 Smart Home & IoT → Smart Cities 48 mobility 1264 transportation 2851 app 4595 travel 7210 Moerdijk → Zevenbergschen Hoek 669
defryskemarren.nlMunicipality of De Fryske MarrenThe website of the Municipality of De Fryske Marren provides residents and visitors with access to information, news, and services.Local Government → Municipalities 3026 taxes 500 permits 643 waste 1312 news 15293 event 45199
wdodelta.nlWaterschap Drents Overijsselse DeltaThe Waterschap Drents Overijsselse Delta manages and monitors water in the region, provides information on water management, and offers services related to water and the environment.Government & Administration → Regional Government 367 Nature Conservation → Water Management 1138 drought 45 drinking water 71 water 2501 nature 9094 installation 13742 De Fryske Marren → Echten 54
de.nlDouwe EgbertsThe website of Douwe Egberts NL offers coffee products and initiatives, with a focus on sustainability and community connection.Volunteering → Community Initiatives 523 Coffee & Tea → Coffee 1064 coffee 3838 history 7286 community 7931 sustainability 18451 De Fryske Marren → Joure 689
nhnieuws.nlNH NieuwsNH Nieuws is a news website that reports the latest news and events from the province of North Holland.Online Marketing → Social Media Marketing 1002 Local & Regional → Local News Websites 358 channel 340 sport 4228 region 5412 news 15293 event 45199 Velsen → Santpoort-Noord 606
hoekstraenpartners.nlHoekstra & Partners NotarissenHoekstra & Partners Notarissen is a collaborative network of notaries with six offices across the Netherlands, providing legal services for various notary matters.Notaries → Notary Office 82 legal services 241 notary 791 address 901 netherlands 1376 office 2898 collaboration 16036 De Fryske Marren → Joure 689
dechristoffel.nlHoly Christoffel ParishThe Christoffel is an online guide for Catholic parishes in Southwest Friesland, providing information on services, activities, and news.Catholic Churches → Dutch Churches 10 Catholic → Parishes 457 sacraments 89 parish 353 news 15293 De Fryske Marren → Balk 224
vario-onderwijsgroep.nlVario OnderwijsgroepThe website of Vario Onderwijsgroep presents information about their educational offerings and schools.Higher Learning → Educational Institutions 1049 student 7623 school 7856 education 13471 collaboration 16036 De Fryske Marren → Lemmer 1188
designate.nlDesignateDesignate is a web development company specializing in the creation and management of websites, webshops, and CMS solutions.E-Commerce → Webshop Development 950 Online & Digital → Internet Services 1004 responsive design 77 cms 613 domain 1811 hosting 3125 webshop 8648 De Fryske Marren → Lemmer 1188
holland-vakantiehuis.nlHolland-vakantiehuis.nlThe website Holland-vakantiehuis.nl offers a platform to find and book holiday homes, bungalows, apartments and other accommodations in the Netherlands and abroad.Accommodation → Bungalows 1008 Accommodation → Bungalow Parks 931 bungalow 687 search 1027 holiday 2295 holiday home 2753 accommodation 4921 region 5412 Friesland → Dutch Wadden Islands 243
enjoy.nlEnjoy.nlThis website offers weekend getaways and day trips throughout the Netherlands.Family Activities → Day Trips 419 Events → Weekend Getaways 106 weekend getaway 20 day trip 257 destination 2580 Schagen → Dirkshorn 105
sellingnet.nlSellingnetThe website Sellingnet offers commercial training and coaching for sales professionals and teams.Business Strategy → Business Development 730 Sales → Sales Management 92 methodology 332 assessment 1205 account 5781 sale 5930 coach 25810 training 28133 De Fryske Marren → Balk 224
hisgis.nlHisGISThe HisGIS website provides digital historical maps and information about various regions of the Netherlands, including the coastlines and cities of North Holland and Zeeland.Computer Science → Geographic Information Systems (GIS) 66 Graphic Design & Printing → Graphic Arts 1034 maps 331 city 1875 data 5872 De Fryske Marren → Balk 224
icy.nlICY B.V.ICY B.V. develops and supplies wireless control systems for various sectors, including campsites, bungalow parks, and marinas.Energy → Energy Management 504 marina 487 holiday park 566 campsite 2093 energy 9075 De Fryske Marren → Lemmer 1188
ingrado.nlIgradoIgrado is an organization dedicated to the development of young people, particularly those in vulnerable situations, and works to combat truancy in the West-Friesland region.Social Services → Youth Support 530 Educational Policy & Systems → Compulsory Education 15 webinar 870 magazine 2182 education 13471 collaboration 16036 De Fryske Marren → Lemmer 1188
dronepanorama.nlDronePanoramaThe website DronePanorama offers professional drone imagery, including interactive panoramas, photos, and videos, to businesses and events.Architecture → Visualization 180 Photography → Drone Photography 237 sphere 10 drone imagery 11 panorama 84 video 6714 photo 7778 event 45199 De Fryske Marren → Balk 224
itfm.nlIT Friese MerenIT Friese Meren is a full-service IT company that provides a variety of ICT solutions and services.IT → System Administration 610 Software & Computing → Cloud Computing 1253 computer maintenance 14 it services 130 microsoft 365 430 telephony 494 network 11123 De Fryske Marren → Lemmer 1188
westfriesmuseum.nlWestfries MuseumThe Westfries Museum website informs visitors about the temporary closure and renovation of the museum, and offers alternative ways to discover the history of Hoorn and West-Friesland.Museums → Historical Museums 341 Sustainable Building → Construction Projects 823 architect 609 monument 1168 museum 2002 exhibition 5332 history 7286 renovation 13849 De Fryske Marren → Lemmer 1188
sneeknet.nlSneeknetThis website provides information about the city of Sneek in Friesland, including its history, location, attractions, and tourism opportunities.Local History → Dutch History 1067 Vacations → City Breaks 536 canal 507 friesland 692 museum 2002 De Fryske Marren → Goingarijp 86
aquacombi.nlAquacombiAquacombi is a supplier of water softening equipment since 1993, offering products, support, and knowledge about water treatment.Water Technology → Water Softening 10 knowledge center 131 water treatment 166 water softener 324 online shop 1310 De Fryske Marren → Joure 689
skarsterbrege.nlPlaatselijk Belang ScharsterbrugThe Skarsterbrege website provides a central information point for the village of Scharsterbrug, focusing on its history, agenda, and local organizations.Local Government → Village Council 479 Village Focus → Village Organizations 683 agenda 4374 history 7286 association 8562 De Fryske Marren → Scharsterbrug 16
doppio-espresso.nlDoppio Espresso Holding B.V.Doppio Espresso is a coffee chain offering multiple locations and online options.Food & Beverage → Franchising 254 Beauty → Tanning Beds 237 franchise 284 online shop 1310 coffee 3838 menu 13856 De Fryske Marren → Joure 689
leviaan.nlLeviaanLeviaan provides guidance and supported living to individuals with mental vulnerabilities.Housing → Social & Supported Housing 858 Health → Mental & Emotional Well-Being 23704 personal budget 17 supported living 26 work 3122 De Fryske Marren → Lemmer 1188
kisgroup.nlKIS Group NederlandThe website of KIS Group Nederland presents lifting and hoisting solutions, services, and expertise in crane construction and CNC machining technology.Industrial Equipment & Services → Machine Building 665 Technical Services → Maintenance Companies 517 cnc machining 56 consulting 3639 maintenance 20093 De Fryske Marren → Joure 689
radiospannenburg.nlRadio SpannenburgRadio Spannenburg is a regional radio station providing news, events, and music to the area of De Fryske Marren.Radio → Regional Radio 115 News & Journalism → Regional News 948 skûtsje 57 radio 1200 news 15293 event 45199 De Fryske Marren → Joure 689
woudagemaal.nlStichting Vrienden van het WoudagemaalThe website of the Woudagemaal presents information about this UNESCO World Heritage site, a functioning steam mill in Friesland.Historical Sites → Monuments 1027 Primary Education → Educational Materials 711 unesco 51 steam 147 water 2501 arrangement 3104 De Fryske Marren → Lemmer 1188
accolade.nlAccoladeThe website provides information about Accolade’s social housing projects, locations, and contact details.Social & Supported Housing → Social Housing 361 social housing 35 rental property 211 repair 14576 Smallingerland → Drachten 2052
menaldumdorp.nlVereniging DorpsbelangThe website provides information about the village of Menaam (Menaldum) and is maintained by its residents, aiming to improve the quality of life and represent the community's interests.Senior Organizations → Local Senior Organizations 31 Village Focus → Village Organizations 683 interest 911 history 7286 photo 7778 news 15293 event 45199 De Fryske Marren → Balk 224
omring.nlOmringOmring provides home care, rehabilitation, and residential care services in North Holland.Essential → Health 91589 home care 827 rehabilitation 1512 equipment 4143 housing 4378 care 12338 De Fryske Marren → Lemmer 1188
kws-sneek.nlKoninklijke Watersportvereniging SneekThe website of the Koninklijke Watersportvereniging Sneek (KWS) is a resource providing information about the association, its activities, facilities, and events on the Sneekermeer.Boating → Harbors 252 harbor 691 competition 4759 association 8562 training 28133 event 45199 De Fryske Marren → Goingarijp 86
greenjoy.nlGreenjoyGreenjoy offers electric boat rentals in various locations, including Alkmaar, Haarlem and Leeuwarden, with attractive prices.Recreational Vehicles → Caravans 820 Water → Boats 935 availability 256 boat 2980 reservation 3373 route 3425 package 6112 Tytsjerksteradiel → Hurdegaryp 114
hoteljans.nlHotel & Restaurant JansThe website of Hotel & Restaurant Jans presents the hotel and restaurant, focusing on its location in Gaasterland, Friesland, and the amenities and services offered, including accommodation, meals and event spaces.Hotels → 3-Star Hotels 14 Cafes → Dutch Restaurants 1031 meeting 2381 room 3411 hotel 3543 wedding 4258 restaurant 11215 De Fryske Marren → Rijs 32
veldsink.nlVeldsink AdviesThe website offers financial advice for private situations.Pensions → Pension Planning 234 savings 457 pension 1682 mortgage 4564 insurance 6359 Vijfheerenlanden → Ameide 97
suppen.nlSUPPEN.nlThe Suppen.nl website is a resource for all things related to stand-up paddleboarding (SUP).Water Sports → SUP (Stand-Up Paddleboarding) 10 sup 233 forum 1362 route 3425 news 15293 Waadhoeke → Tzum 30
husenhiem.nlhûs en hiemThe website of hûs en hiem is an advisory organization that represents the common interests of the Frisian municipalities regarding environmental quality.Planning & Development → Spatial Planning 889 Nature → Environmental Management 529 landscape 2609 Friesland → Dantumadiel 429
huurportaal.nlHuurportaalHuurportaal.nl is an online platform connecting renters directly with private landlords in the Netherlands.Property Location & Neighborhood → Property 695 Accommodation → Rental Properties 214 owner 515 rent 981 agent 1253 advertisement 1707 apartment 5088 property 7406 Stichtse Vecht → Maarssen 1051
vakantiemakelaar.nlVakantiemakelaarThe website of ‘De Vakantiewoningen Specialist’ offers a wide selection of holiday homes, recreational homes and chalets for sale and for sale via a ‘Vrij Op Naam’ (Free of Name) action.Investing → Real Estate Investing 707 recreational home 67 yield 292 park 1863 holiday home 2753 Westerwolde → Bourtange 85
mooieplek.nlZwanenburg ProjectenZwanenburg Projecten is a company specializing in the development and redevelopment of areas, creating innovative residential concepts.Real Estate → Housing 11120 Real Estate & Investment → Construction Development 55 vision 1882 concept 3338 home 7976 collaboration 16036 De Fryske Marren → Langweer 93
springkussenverhuur-nederland.nlSpringkussenverhuur NederlandSpringkussenverhuur Nederland is a company that rents and supplies bouncy castles, slides, and other party supplies throughout the Netherlands.Parties → Party Supplies 1108 Outdoor → Play Equipment 313 slide 104 branch 268 bouncy castle 366 party supplies 394 Moerdijk → Zevenbergschen Hoek 669
1beautyafspraak.nl1BeautyAfspraak BVThe website 1BeautyAfspraak.nl provides an online agenda for users to easily book appointments with various beauty salons, nail studios, massage salons, and tanning studios in the Netherlands.Wellness → Commercial Businesses 130 hairdresser 1372 agenda 4374 salon 5541 appointment 13510 treatment 21203 De Fryske Marren → Sint Nicolaasga 146
sportbedrijfdfm.nlSportbedrijf De Fryske MarrenSportbedrijf De Fryske Marren is a self-governing community organization dedicated to making sport and movement accessible to everyone in the municipality of De Fryske Marren.Spa → Saunas 920 Body & Movement → Exercise 1005 gym 699 swimming pool 1664 movement 2304 sport 4228 municipality 6837 collaboration 16036 De Fryske Marren → Joure 689
klompmaker.nlJachtcharter KlompmakerJachtcharter Klompmaker offers luxury motor yachts for rent in Friesland and surrounding areas, allowing visitors to explore the Dutch countryside from the water.Vacations → Water Travel 978 Water → Boats 935 kotter 14 sailing area 28 yacht 647 brochure 1642 water 2501 vacation 4234 De Fryske Marren → Lemmer 1188
stepforstep.nlStep for StepStep for Step is a pedicure practice offering expert pedicures and foot treatments, with a particular focus on individuals with diabetes or rheumatism.Foot Care → Medical Foot Care 710 Chronic Diseases → Diabetes 349 rheumatism 219 diabetes 750 foot 1929 pedicure 2196 treatment 21203 De Fryske Marren → Lemmer 1188
witeburch.nlRecreatiepark De Wite BurchRecreatiepark De Wite Burch offers accommodations such as chalets, campsites, and cabins in Gaasterland to visitors.Camping → Farm Camping 386 chalet 1264 camp 2466 accommodation 4921 nature 9094 De Fryske Marren → Bakhuizen 45
vakantieadressen.nlVakantiehuizen Nederland B.V.The website offers a wide selection of holiday homes and luxury group accommodations in the Netherlands.Accommodation → Group Accommodation 844 AccommodationTypes → Groups 10 holiday farm 49 group accommodation 260 pet 1617 bedroom 2051 holiday home 2753 region 5412 Dinkelland → Lattrop-Breklenkamp 75
nijegaast.nlStichting Nije GaastStichting Nije Gaast is a foundation that manages primary schools and childcare in the Frisian lake area, aiming to support children’s development.Knowledge → Education 69666 childcare 3512 environment 4873 foundation 6678 school 7856 education 13471 De Fryske Marren → Balk 224
witwognum.nlAannemingsbedrijf Wit Wognum B.V.The website of Aannemingsbedrijf Wit Wognum B.V. presents the company, its history, services, projects, and contact information.Finishing & Trades → Finishing 547 Sustainable Building → Construction Projects 823 contract 2415 certification 3380 renovation 13849 De Fryske Marren → Lemmer 1188
westfriesezaken.nlWestfriese ZakenThe website of Westfriese Zaken presents news, events and advertising related to entrepreneurs in Westfriesland.Local News → North Holland 22 News & Journalism → Regional News 948 gala 114 networking 842 innovation 4659 sustainability 18451 De Fryske Marren → Lemmer 1188
kappio.nlKappio KinderopvangKappio Kinderopvang is a childcare organization that provides a playful and educational environment for children aged 0 to 12.Early Years → Childcare 6029 after-school care 196 preschool 495 daycare 1365 childcare 3512 parent 4318 Hollands Kroon → Anna Paulowna 291
inloophuismedemblik.nlStichting Inloophuis MedemblikThe Inloophuis Medemblik offers support and information to individuals facing cancer, life-threatening illnesses, and their loved ones.Online Communities → Support Groups 102 Specialty Medicine → Cancer Care 97 inloophuis 21 hostess 165 cancer 631 brochure 1642 theme 4015 volunteer 8367 De Fryske Marren → Lemmer 1188
heegsmabv.nlHeegsma BVThe website of Heegsma BV showcases a wide range of high-quality root vegetables and other full-season vegetables, with a focus on conventional and organic products.Supply Chain & Logistics → Trade 2141 Environment → Agriculture 11160 carrot 15 organic products 87 potato 542 De Fryske Marren → Lemmer 1188
noord-computers.nlNoord ComputersNoord Computers provides a range of computer services, including repairs, cloud solutions, and advice, and now also sells Apple products.Computer → Computer Repair 898 Computer → Computer Support 1003 apple 321 computer 1969 window 2030 security 6655 software 8291 De Fryske Marren → Joure 689
tandartslemmercentrum.nlTandartspraktijk Lemmer CentrumTandartspraktijk Lemmer Centrum is a dental practice offering a range of services, including preventative care, cosmetic treatments, and implants.Medical Care & Services → Primary Care 5699 dentist 2514 child 11566 appointment 13510 treatment 21203 Amsterdam → Sloten 146
skutsjesilen.nlSKS SkûtsjesilenThis website of SKS Skûtsjesilen presents information about the traditional sailing competition for skûtsjes in Friesland, including a schedule of races, standings, and historical data.Sailing → Traditional Sailing 19 Running → Races 266 skûtsjesilen 17 standings 143 race 1043 sponsors 2642 history 7286 De Fryske Marren → Lemmer 1188
tandarts.nlTandarts.nlThis website provides information about all aspects of oral health, including dental anxiety, emergency treatments, and a list of dentists by location.Adult & Continuing Learning → Professional Development 2080 Health → Medical Care & Services 29461 oral health 686 prevention 1763 dentist 2514 treatment 21203 Pijnacker-Nootdorp → Pijnacker 788
hetpark.nlSchouwburg Het ParkSchouwburg Het Park is a theater offering professional performances, regional talents, concerts, and parties for the Hoorn and West Friesland region.Festivals → Regional Festivals 82 Local & Regional → Organized Events 45 ticket sales 112 theater 2544 agenda 4374 region 5412 event 45199 De Fryske Marren → Lemmer 1188
woesteland.nlWoesteLandWoesteLand organizes active youth holidays and activities in nature, targeting various age groups and offering opportunities for volunteer work.Vacations → Nature Vacations 269 camp 2466 leadership 3724 vacation 4234 story 8285 volunteer 8367 nature 9094 De Fryske Marren → Echten 54
balkstercourant.nlMediahuisThe Balkster Courant is a local newspaper providing news, events, and advertisements from the region of Balk and surrounding areas.News & Journalism → Local Newspapers 38 Context 161394 village 808 advertisement 1707 region 5412 news 15293 event 45199 De Fryske Marren → Balk 224
nnhf.nlNoord Nederlandse Handboog FederatieThe Noord Nederlandse Handboog Federatie (NNHF) is a federation that brings together archery clubs in northern Netherlands and supports the organization of competitions and other activities.Shooting → Archery 259 results 3954 club 4225 competition 4759 member 10154 Southwest-Friesland → Sneek 1921
burggolf.nlHollandsche GolfclubThe Hollandsche Golfclub offers a network of 14 golf parks across the Netherlands where visitors can take golf lessons, book tee times, and enjoy the brasseries.Golf → Golf Clubs 189 golf lesson 138 golf course 507 brasserie 752 arrangement 3104 Altena → Hank 113
zorggroepsintmaarten.nlZorggroep Sint MaartenThe website of Zorggroep Sint Maarten provides information and services for clients, employees, volunteers, referrers, and potential tenants.Sustainable Living → Housing Associations 325 Rental Properties → Tenant Associations 351 nursing home care 10 rental housing 38 palliative care 140 home care 827 rehabilitation 1512 wellbeing 2620 Dinkelland → Oud Ootmarsum 16
schulman.nlSchulman b.v.The website of Schulman b.v. is a platform for the sale and valuation of coins, medals, and paper money, with a focus on auctions and online bidding.Home → Antiques & Collectibles 1523 coin 313 auction 561 catalog 812 valuation 2697 Wageningen → Wageningen Center 64
kavb.nlKoninklijke Algemeene Vereeniging voor Bloembollencultuur (KAVB)The KAVB is a branch association for the flower bulb sector in the Netherlands, focused on advocating for the interests of the sector, sharing knowledge, and providing services to its members.Horticulture & Floristry → Flower Bulbs 22 Associations & Groups → Industry Associations 548 cultivar 26 flower bulbs 66 entrepreneurship 1579 knowledge 3528 member 10154 sustainability 18451 De Fryske Marren → Lemmer 1188
swimfun.nlSwimfunSubtropisch Zwembad Swimfun in Joure is an indoor swimming pool offering water fun and recreation for families and individuals.Parties → Birthday Parties 1008 Water Sports → Water Parks 31 attraction 1275 pool 1532 De Fryske Marren → Joure 689
pknechtenerbrugoosterzee.nlPKN Echtenerbrug-OosterzeeThe website of PKN Echtenerbrug-Oosterzee provides information about the Protestant Church in the Netherlands (PKN) community, its activities, services, and contact details.Reformed → Church Organization 155 Religion → Protestant Church in The Netherlands 16 minister 60 church service 879 agenda 4374 community 7931 De Fryske Marren → Echtenerbrug 24
hoornradio.nlStreekomroep West-FrieslandHoornRadio, merged with Stichting Streekomroep West-Friesland, provides regional news and radio broadcasts for the municipalities of Hoorn, Zwaag, and Blokker.Radio → Regional Radio 115 News & Journalism → Regional News 948 radio 1200 region 5412 municipality 6837 news 15293 event 45199 De Fryske Marren → Lemmer 1188
desintnykster.nlThúsThe website provides regional news and information from Sint Nicolaasga and surrounding areas.News & Journalism → Regional News 948 bridge 557 swimming pool 1664 association 8562 news 15293 event 45199 De Fryske Marren → Sint Nicolaasga 146
hofenhiem.nlZorggroep Hof en HiemThe website of Zorggroep Hof en Hiem presents the services and locations of a care organization focused on home care, residential care, daycare, and other supporting services.Care → Residential Care 305 assisted living 21 home care 827 job vacancies 1241 daycare 1365 volunteer 8367 De Fryske Marren → Balk 224
borgergroep.nlScouting De Borgergroep JoureThe website of Scouting De Borgergroep Joure provides information about the organization, its activities, scout troops, and opportunities to become a member.Youth Organizations → Scouting 1004 Organizations → Community Organization 17 troop 77 age group 93 clubhouse 784 scouting 860 volunteer 8367 De Fryske Marren → Joure 689
psvdeoorsprong.nlPSV de Oorsprong Equestrian Sports AssociationThis website provides information about the equestrian sports association PSV de Oorsprong, including its organization, activities, membership, and accommodation.Swimming → Swimming Clubs 242 equestrian association 14 match report 18 accommodation 4921 membership 10442 De Fryske Marren → Sint Nicolaasga 146
mcdonaldsrestaurant.nlMcDonald's NetherlandsThe website aims to provide potential customers with information about the locations of McDonald's restaurants in the Netherlands.Websites → Restaurant Websites 14 TravelContent → Maps 141 address 901 restaurant 11215 The Hague → Scheveningen 1625
demeenthe.nlRabo Theater De MeentheThe Rabo Theater De Meenthe is a cultural center in Steenwijk that offers performances and events to visitors and organizations.Venues → Event Spaces 432 event hall 93 hall rental 124 theater 2544 catering 6456 performance 7586 De Fryske Marren → Balk 224
campinghindeloopen.nlCamping HindeloopenCamping Hindeloopen is a family-friendly campsite on the IJsselmeer in Friesland, offering camping facilities, rental accommodations, and an environment with opportunities for watersports and relaxation.Campsites → Campsites in The Netherlands 19 Water Sports → Windsurfing 127 watersport 540 campsite 2093 child 11566 Southwest-Friesland → Hindeloopen 127
sari-fairfashion.nlSari Fair FashionSari Fair Fashion is a store specializing in fair trade clothing, sustainable garments, and accessories with a focus on respect for people and the environment.Coffee → Specialty Coffee 20 Commerce → Fair Trade 191 fairtrade 200 certification 3380 assortment 7799 clothing 9443 sustainability 18451 De Fryske Marren → Joure 689
madelen.nlMadelen EssensThe website offers computer lessons in programs like Word, Excel, and website creation, with options for in-home instruction or at specific locations.Computer → Computer Support 1003 excel 228 whatsapp 382 ipad 404 internet 1678 De Fryske Marren → Balk 224
trientsje.nlBorduurstudio TrientsjeBorduurstudio Trientsje is an online shop selling embroidery tools and software.Crafts → Handmade 1147 prestashop 42 cart 381 shop 6483 software 8291 De Fryske Marren → Joure 689
thomasvaer.nlThomasVaer FotografieThe website of ThomasVaer Fotografie showcases the work of a skûtsje photographer, primarily related to the Friesian skûtsjesilen, and offers a range of services including business and commercial photography, as well as the sale of wall decor featuring the photos.Sailing → Traditional Sailing 19 skûtsjesilen 17 skûtsje 57 wall decor 213 photography 9503 De Fryske Marren → Lemmer 1188
westreiniging.nlWEST ReinigingWEST Reiniging is a specialist in exterior cleaning offering a range of cleaning and maintenance services.Maintenance & Services → Facade Maintenance 673 Cleaning Services → Facade Cleaning 418 impregnation 187 graffiti 243 facade 1490 roof 3662 solar panels 4701 Ooststellingwerf → Appelscha 331
techportal.nlTechportalTechportal informs and inspires education in North Holland about context-rich teaching, emphasizing collaboration between schools and businesses.Digital Media & Design → Creative Technology 12 Special Needs & Support → Educational Organizations 315 lesson program 71 technology 6816 school 7856 education 13471 Velsen → Santpoort-Noord 606
csgbogerman.nlcsg BogermanThe website of csg Bogerman provides information about various educational institutions and events, aiming to inform potential students and encourage them to contact the school.Primary & Secondary Schooling → Secondary Education 1639 Educational Policy & Systems → Educational Networks 14 education 13471 collaboration 16036 event 45199 Southwest-Friesland → Koudum 134
karstentravelstore.nlKarsten TravelstoreThe website is an online shop and store specializing in camping equipment and travel.Kitchen → Kitchen Appliances 724 Family Fun → Camping 3312 cookware 101 sleep 746 tent 1328 clothing 9443 accessories 12975 De Fryske Marren → Lemmer 1188
sscdesom.nlShared Service Center DeSomShared Service Center DeSom is an ICT cooperation that develops digital solutions for local governments in West Friesland.Enterprise Solutions → Business Systems 91 Technology → ICT 486 west-friesland 41 digital solutions 96 ict 1049 collaboration 16036 De Fryske Marren → Lemmer 1188
nesko.nlNederlands Studenten KamerorkestThe website provides information about the Nederlands Studenten Kamerorkest (Nesko), a student chamber orchestra.Orchestras → Chamber Orchestras 73 Local Life → Local Culture 381 orchestra 1315 concert 4409 student 7623 De Fryske Marren → Sint Nicolaasga 146
binnenvaartkennis.nlBinnenvaart KennisThe website provides information and resources related to inland navigation in the Netherlands, Belgium, and Germany.Water Transportation → Inland Navigation 161 Agriculture → Agricultural Technology & Innovation 743 inland navigation 26 water level 35 waterway 120 locks 953 communication 10162 Altena → Werkendam 399
skowf.nlStichting Katholiek Onderwijs West-FrieslandThe website of Stichting Katholiek Onderwijs West-Friesland presents information about Catholic education in the West-Friesland region, including the 22 primary schools and the activities of the school board.Municipalities → Westfriesland 12 Primary Education → Catholic Primary Education 380 vision 1882 employee 4429 student 7623 school 7856 education 13471 De Fryske Marren → Lemmer 1188
legendcorporation.nlLegend CorporationLegend Corporation provides funeral products and online services to funeral homes, crematoria, and wholesalers globally.Family → Funeral Services 2084 memory 1641 relationship 4205 De Fryske Marren → Lemmer 1188
lemsterkade.nlDeveloper (Not specifically mentioned in the text)The website showcases the Lemsterkade development project in Lemmer, where phase 2 is being marketed with apartments, penthouses, and canal houses, with a focus on repurposing a historic industrial complex.New Construction → Neighborhood Development 933 canal house 60 penthouse 108 industrial 156 apartment 5088 history 7286 De Fryske Marren → Lemmer 1188
deheidepleats.nlNij Abdij de HeidepleatsNij Abdij de Heidepleats is a domain combining vineyards, cheeses, B&B accommodation, and a historic farmstead.Accommodation → B&B 25 Nature → Estates 771 vineyard 260 b&b 1060 estate 1099 cheese 1205 walk 2161 wine 4476 De Fryske Marren → Sint Nicolaasga 146
eysingastate.nlLandgoed Eysinga StateVakantiepark Eysinga State is a holiday park in Friesland offering accommodations and various activities in a water-rich environment.Accommodation → Holiday Parks 1024 Accommodation → Group Accommodation 844 golf 319 lake 352 forest 1418 camp 2466 accommodation 4921 De Fryske Marren → Sint Nicolaasga 146
vitas.nlVitas Holding B.V.Vitas is a company that helps organizations develop software, specifically in the field of Microsoft technology.Cloud Computing → Microsoft Azure 68 Education & Training → Career 1765 microsoft 183 devops 197 azure 222 vacancy 6598 software 8291 De Fryske Marren → Joure 689
trustus.nlTrustusTrustus offers customized wealth management services, specializing in personalized asset development and management.Investing → Wealth Management 435 Personal Wealth → Retirement 769 life insurance 36 wealth management 74 pension 1682 investment 2070 goal 4974 De Fryske Marren → Joure 689
kidzy.nlKidzyThe Kidzy.nl website provides tips and original ideas for children's parties, both indoors and outdoors, and focuses on finding suitable activities in the Netherlands.Pastry → Cakes 826 Parties → Birthday Parties 1008 children's party 115 treat 373 tips 2789 region 5412 price 8328 De Fryske Marren → Lemmer 1188
vandervelde-hoen.nlVan der Velde & HoenThis website, belonging to Van der Velde & Hoen, is a real estate agency operating in Friesland, Groningen, and Ameland, offering services for the sale, valuation, and purchase of homes and commercial properties.Property Finance → Purchase 493 Real Estate → Commercial Property 1840 real estate market 25 purchase 2212 valuation 2697 sale 5930 property 7406 house 8121 De Fryske Marren → Lemmer 1188
dynhus.nlDynhusThe Dynhus website provides services and information related to housing rental, sales, repairs, maintenance, and projects, with a focus on sustainability and residential livability.Rental Properties → Renting 386 Homeownership & Management → Housing Corporations 426 heat network 101 rent 981 housing 4378 repair 14576 news 15293 De Fryske Marren → Balk 224
streekomroepwestfriesland.nlStreekomroep West-FrieslandStreekomroep West-Friesland is a platform providing news and stories from the West-Friesland region.Blogs & Publications → Regional 272 Context 161394 radio 1200 podcast 3328 municipality 6837 news 15293 event 45199 De Fryske Marren → Lemmer 1188
lemsterlint.nlWaterrijk wonenThe Waterrijk wonen in Lemmer website presents and sells detached houses located on the water in the Lemsterlint, part of the water-rich ‘islands area’ Hof fan Lemmer.Reformed → Dutch Reformed Church 219 Village Focus → Village Life 262 house type 74 livestream 478 house 8121 De Fryske Marren → Lemmer 1188
sociaalwerkdekear.nlSociaal Werk de KearSociaal Werk de Kear provides well-being services to residents of the municipality of De Fryske Marren.Social Services → Welfare 1001 Government & Administration → Municipal Services 834 livability 230 caregiving 368 neighborhood 2424 wellbeing 2620 mediation 2787 volunteer 8367
claassenkozijn.nlClaassen kunststof kozijnenClaassen kunststof kozijnen is a company that sells and installs plastic frames, with showrooms in various locations and a focus on quality and personal service.Frames → Plastic Frames 340 Installation & Repair → Door Installation 19 plastic 1232 frames 2556 showroom 4883 installation 13742 Elburg → Spoorstraat 142
dekikkert.nlZeilschool de KikkertZeilschool de Kikkert is a sailing school in Friesland offering sailing camps and activities for young and old.Sailing → Sailing Schools 70 Youth Development → Youth Education 37 sailing camp 21 instruction 326 sail 965 boat 2980 De Fryske Marren → Lemmer 1188
keukenstudiodestreek.nlKeukenstudio de StreekKeukenstudio de Streek is a kitchen company specializing in both new kitchens and renovations, combining top design with personalized service.Kitchen → Kitchen Appliances 724 showroom 4883 kitchen 6443 design 27202 De Fryske Marren → Lemmer 1188
weekbladzondag.nlWeekblad ZondagThe website, Weekblad Zondag for Westfriesland, provides regional news, advertisements, and various local events.Advertising → Local Advertising 25 News & Journalism → Regional News 948 newspaper 396 advertisement 1707 region 5412 news 15293 event 45199 Drechterland → Venhuizen 154
aes-tg.nlAES Technische GroothandelThe website of AES Technische Groothandel presents the company's activities, products, and services to customers in the industrial, agricultural, automotive, and watersport sectors.Animal Husbandry → Meat Production 123 Business → Industry 36977 sector 1332 webshop 8648 training 28133 De Fryske Marren → Lemmer 1188
tcgrootebroek.nlToerclub GrootebroekThe website of Toerclub Grootebroek presents the cycling association for tourist cyclists and cyclists in West Friesland, with information about club rides, membership, and events.Cycling → Cycling Clubs 522 e-bike 908 ride 1075 cycle 1906 membership 10442 event 45199 De Fryske Marren → Lemmer 1188
degortla.nlThe GortlaThe Gortla is a Bed & Breakfast and home store located in Oosterblokker, West Friesland, offering accommodation and information about the surrounding area.Decor & Furnishings → Home Stores 932 Context 161394 home store 44 bed & breakfast 319 facility 2616 apartment 5088 De Fryske Marren → Lemmer 1188
zeilschoolneptunus.nlZeilschool FrieslandZeilschool Friesland and Zeilschool Neptunus offer sailing lessons, sailing camps, and sailing clinics in Friesland, catering to both children and adults.Sailing → Sailing Schools 70 Family Fun → Children’s Activities 1906 sailing camp 21 sailing school 39 boat rental 124 friesland 692 sail 965
dc058.nlDance Company 058Dance Company 058 is a dance school based in Leeuwarden and surrounding areas, offering dance lessons in various styles including hip hop, modern, and ballet, and also organizes workshops, shows, and potentially venue rentals.Dance → Dance Classes 1003 dance lessons 184 workshop 19325 training 28133 event 45199 De Fryske Marren → Balk 224
flyingboetoe.nlM.C. Flying BoetoeThe website of M.C. Flying Boetoe, a motorcross and baansport club, provides information about the club, its activities, events, and contact details.Motorsport → Motocross 141 Combat → Badminton 702 motorcross 21 circuit 342 competition 4759 training 28133 event 45199 De Fryske Marren → Joure 689
escapeloop.nlEscapeloopEscapeloop.nl offers unique, outdoor escape room experiences, geared towards teams and individuals who enjoy puzzles and challenges.Games → Escape Rooms 410 Events & Activities → Outdoor Activities 1043 mystery 70 escape room 430 puzzle 811 smartphone 1344 environment 4873 Southwest-Friesland → Hindeloopen 127
thextonarmstrong.nlThexton ArmstrongThexton Armstrong is an SME advisory firm helping businesses and professionals achieve better business results and personal goals.Business Process Management → Optimization 76 Digital Media & Design → Digital Transformation 954 entrepreneurship 1579 Rijssen-Holten → Rijssen 1048
learn2kite.nlLearn2kite with MinkThe website of 'Learn2kite with Mink' offers kitesurfing lessons in Friesland, focusing on personalized instruction and the use of modern technology such as Bluetooth communication and GoPro recordings.Water Sports → Windsurfing 127 Water Sports → Kitesurfing 107 gopro 15 bluetooth 91 equipment 4143 course 14728 Southwest-Friesland → Makkum 229
wst-hetgrootslag.nlHet GrootslagThe website of Het Grootslag provides information and services for tenants, prospective homebuyers, and residents of West-Friesland, including rent management, housing availability, contact options, and news.Property Development & Redevelopment → Property Mediation 63 tenant 920 rent 981 housing 4378 repair 14576 news 15293 De Fryske Marren → Lemmer 1188
opendrachten.nlVVV Tourist Info DrachtenThe Open Drachten website is a portal for information about the city of Drachten, focusing on events, attractions, activities, and local services. It provides an event agenda, information about living, learning, and working, and information about the surrounding area.Property Purchase → House Hunting 10 Tourism → Tourist Information 124 culture 3922 agenda 4374 housing 4378 event 45199 De Fryske Marren → Lemmer 1188
autodeinum.nlEurorepar Car ServiceThe website of Autoservice Deinum presents the services of an all-round automotive dealership with a specialization in Peugeot and the affiliation with the Eurorepar Car Service network.Motorcycles → Scooters 903 Repair → Engine Repair 129 peugeot 88 part 5044 car 10865 repair 14576 maintenance 20093 De Fryske Marren → Joure 689
troy.nltroy b.v.The website of Troy describes an invoice collection agency that focuses on combining successful collection with CRM systems to collect outstanding invoices and retain valuable clients.Business Software → CRM 764 crm 591 invoice 795 agency 944 relationship 4205 collection 7566 De Fryske Marren → Lemmer 1188
huisartsenpostwf.nlHuisartsenpost West-FrieslandThe West-Friesland House Officer Post provides urgent medical care outside of regular opening hours.Hospital & Acute Services → Emergency Care 163 opening hours 2953 patient 4082 insurance 6359 complaint 6479 appointment 13510 De Fryske Marren → Lemmer 1188
artemiswinsum.nlArtemis WinsumThis website serves as the official online presence for the hardrunning association Artemis from Winsum, providing information about the association, its members, events, and results.Activity → Athletics 266 results 3954 association 8562 member 10154 event 45199 Westerveld → Old Willem 18
digidoor.nlTolteek BVThe Digitaal Doorstromen application provides login access for employees and students/parents in various municipalities and institutions within the region.National Politics → Politicians 31 Concrete & Cement → Concrete Floors 60 institution 245 application 3377 employee 4429 municipality 6837 student 7623 school 7856 De Fryske Marren → Lemmer 1188
netwerkdementie-nhn.nlNetwork Dementie Noord-Holland NoordThe website of the Network Dementie Noord-Holland Noord serves as a platform for collaboration, knowledge sharing, and project development in the field of dementia care in the North Holland North region, aiming to improve the quality of care for patients and their families.Neurology → Dementia 509 Radio & Communication → Networks 341 dementia 674 knowledge 3528 region 5412 network 11123 care 12338 De Fryske Marren → Lemmer 1188
id11.nlStichting id11Stichting id11 is an organization that organizes small-scale projects, residencies, and events, often with a focus on art, heritage, and location-based work.Art Management & Sales → Art Organizations 255 Community → Government & Administration 10567 residency 100 sponsors 2642 event 45199 De Fryske Marren → Haskerhorne 14
suverthus.nlSuver ThúsSuver Thús provides professional household assistance in Friesland and surrounding municipalities, aiming to support clients in maintaining an independent lifestyle.Social Housing → Small-Scale Housing 44 care team 42 household assistance 90 employee 4429 collaboration 16036 Southwest-Friesland → Sneek 1921
vanwinkelvloeren.nlVan Winkel VloerenVan Winkel Vloeren is a company that supplies high-quality flooring and wall finishes, including plastic floors, self-leveling floors, and wall finishes from Cebos.Flooring → Plastic Flooring 20 commercial floor 12 self-leveling floors 45 wall finishing 310 floor 4781 De Fryske Marren → Lemmer 1188
hout1893.nlHOUT 1893HOUT 1893 is a company that handcrafts Douglas tables and garden furniture, with a focus on customization and sustainability.Crafts → Handmade 1147 garden furniture 578 customization 1723 sustainability 18451 De Fryske Marren → Joure 689
skarweb.nlSkarWebSkarWeb offers complete internet solutions for businesses, including web design, hosting, domain registration, and search engine optimization.Providers → Domain Names 1466 Mathematics → Statistics 101 statistics 392 domain 1811 hosting 3125 webdesign 4092 De Fryske Marren → Scharsterbrug 16
springkussenverhuur-westfriesland.nlSpringkussenverhuur West FrieslandThe website Springkussenverhuur West Friesland offers the rental of bouncy castles, inflatable slides, games and party supplies for parties and events in West Friesland and the surrounding area. The aim is to provide customers with quality rental and an unforgettable party experience.Parties → Party Supplies 1108 Event Rental → Bouncy Castles 161 inflatable slide 38 bouncy castle 366 party supplies 394 attraction 1275 party 5928 rental 7257 Medemblik → Andijk 242
feesthoorn.nlFeestHoornFeestHoorn is a balloon shop specializing in providing balloon decorations for parties and events.Party Supplies → Balloons 117 Parties → Party Decorations 151 balloon arch 56 inflatable figure 109 balloon 554 decoration 4085 event 45199 De Fryske Marren → Lemmer 1188
pgjoure.nlProtestantse Gemeente JoureThe Protestant Community of Joure provides information about services, events, diaconal measures, pastoral activities and historical data.Protestantism → Reformed 1323 Education & Youth → Local Organization 65 church service 879 schedule 2624 volunteer 8367 event 45199 De Fryske Marren → Goingarijp 86
cafetaria-langweer.nlCafetaria-IJssalon 't HoekjeCafetaria-IJssalon 't Hoekje is a cafeteria and ice cream parlor located in Langweer, offering a variety of meals, snacks, and ice cream, with special options for dietary restrictions and vegetarians/vegans. The website provides information about opening hours, delivery and special menu options.Quick Bites → Cafeteria 906 Chocolate & Sweets → Ice Cream 774 ice cream 1000 fries 2753 snack 2916 sandwich 4098 menu 13856 De Fryske Marren → Langweer 93
booibrothers.nlBooi Brothers WatersportBooi Brothers Watersport is a company offering various services in the watersport and campervan building industries.Family Fun → Camping 3312 Transportation → Marine & Watercraft 2309 campervan 145 stables 212 watersport 540 boat 2980 maintenance 20093 De Fryske Marren → Langweer 93
bakkerij-otten.nlBakkerij OttenBakkerij Otten is a family bakery with a long tradition offering bread, pastries, and cakes, with delivery services.Agriculture → Bakery & Food Production 1193 family business 793 pastries 946 bread 1622 cake 1730 employee 4429 De Fryske Marren → Lemmer 1188
dewichterij.nlThe WichterijThe website of ‘The Wichterij’ is focused on promoting and preserving the tradition of the Wichter, a regional product of the Fryske Wâlden.Beverages → Liqueurs 121 National Identity → Regional Culture 177 recipe book 29 liqueur 167 De Fryske Marren → Terkaple 24
hollendstilstaan.nlHollend stilstaanHollend stilstaan offers training and coaching outdoors, aiming to promote physical and mental balance through movement techniques such as ChiWalking, Chi Running, and Breathing exercises. The organization focuses on encouraging a more relaxed and vital lifestyle.Therapy → Alternative Therapies 865 Outdoor Adventures → Walking 1260 breathing exercises 56 movement 2304 coach 25810 training 28133 De Fryske Marren → Lemmer 1188
kameleonhofje.nlKameleonhofje TerherneThe Kameleonhofje website showcases a new housing development in Terherne, featuring a blend of courtyard houses and barn houses, surrounded by water and natural landscapes.Garden → Ponds 280 water 2501 De Fryske Marren → Terherne 98
fotonantko.nlFotograaf NantkoThe website of Fotograaf Nantko in Joure, Friesland, offers a variety of photographic services including passport photos, digital services, photography, printing services (including blueprints), binoculars, canvas prints, and portrait photography, and also offers a copy shop with printing and scanning facilities.Visual Arts → Framing 139 digital services 53 binocular 70 passport photo 227 print 5511 photography 9503 De Fryske Marren → Joure 689
slagerijdejager.nlSlagerij J. de JagerThe website of Slagerij J. de Jager presents the products and services of a traditional butcher shop in the Oppenhuizen and Uitwellingerga region, with a focus on quality and artisanal preparation.Supermarkets & Grocery → Butchers 747 Nature → Waterways 161 artisan 94 sausage 256 beef 319 meal 1638 meat 2055 gift 6442 Southwest-Friesland → Oppenhuizen 41
berendschothoreca.nlBerendschot Horeca Makelaardij en AdviesBerendschot Horeca Makelaardij en Advies is a real estate agency and advisory firm specializing in the sale, acquisition, and valuation of restaurants and cafes.Real Estate → Commercial Property 1840 business coaching 79 inventory 1613 valuation 2697 real estate 4981 restaurant 11215 Steenwijkerland → Belt-Schutsloot 29
bedrijven-index.nlBedrijven-Index.nlBedrijven-Index.nl is a business directory that provides information about municipalities and businesses in the Netherlands.Social Issues → Social Innovation 93 Office & Workspace → Business Directories 421 perspective 882 video 6714 municipality 6837 Purmerend → Middenbeemster 367
baerveldt.nlBaerveldt Beheer B.V.The website presents the activities of several companies, including Baerveldt Beheer B.V., Beleenbank Pandhuys Joure, Van der Meulen Edelmetaal B.V., and Stoeterij Bommelsteyn B.V., and provides links to their individual websites.Animal Husbandry → Horse Breeding 230 precious metal 78 bank 374 silver 479 breed 1744 real estate 4981 De Fryske Marren → Joure 689
springkussenverhuur-leeuwarden.nlSpringkussenverhuur LeeuwardenThe website of Springkussenverhuur Leeuwarden offers rentals of bouncy houses, inflatable slides, party supplies, and more, with a focus on organizing unforgettable parties and events in Leeuwarden and surrounding areas.Outdoor → Play Equipment 313 Rental Services & Equipment → Rental Products 66 bouncy house 42 party supplies 394 party 5928 De Fryske Marren → Joure 689
bergsmamotoren.nlBergsma MotorenBergsma Motoren is a shop that sells motorcycles, motorcycle clothing, and accessories and provides motorcycle maintenance services.Parts → Motorcycle Parts 488 Property Finance → Purchase 493 carburetor 47 motorcycle clothing 80 motorcycle 2110 part 5044 workshop 19325 maintenance 20093 De Fryske Marren → Balk 224
bedrijvenwegwijzer.nlBedrijvenwegwijzer.nlBedrijvenwegwijzer.nl is a directory providing information about municipalities and companies in the Netherlands.Office & Workspace → Business Directories 421 Economy → Local Economy & Development 721 directory 176 video 6714 municipality 6837 Purmerend → Middenbeemster 367
friesebewakingsdienst.nlFriese bewakingsdienstThe Friese Bewakingsdienst provides security services in Friesland and surrounding areas, including event security, fire watch, and security equipment, via an online store.Context 161394 nightwatch 13 identification 76 webstore 134 festival 3804 security 6655 event 45199 Southwest-Friesland → Bolsward 566
degeling.nlRijschool Degeling HoornThe website of Rijschool Degeling Hoorn offers information and the possibility to book driving lessons for obtaining a driver's license in Hoorn and West Friesland. The driving school emphasizes a personal approach, high pass rates, and affordable prices.Educational Services → Driver’s License Courses 159 Rental Services → Car Rental 1047 fear of failure 51 pass rate 198 driver’s license 438 exam 2120 driving lessons 2453 instructor 3126 De Fryske Marren → Lemmer 1188
tolkerbosch.nlGastenverblijf TolkerboschGastenverblijf Tolkerbosch is a holiday accommodation in Schagen, North Holland, offering holiday apartments and a holiday house.Holiday Homes → Beach Houses 277 Accommodation → Group Accommodation 844 bedroom 2051 farm 2622 beach 3210 terrace 4847 apartment 5088 house 8121 De Fryske Marren → Lemmer 1188
exigent.nlExigent WebservicesThe website of Exigent Webservices showcases various IT solutions, including website development and maintenance, alongside a portfolio of clients and projects.Web Development → Content Management Systems 502 Online & Digital → Digital Services 1008 website building 13 it solutions 181 cms 613 portfolio 6854 De Fryske Marren → Sint Nicolaasga 146
peugeot203.nlPeugeauto RavensteinThis website documents the restoration of a Peugeot 203 C from 1955, including photos, news, and a guest book.Cars → Classic Cars 1145 car enthusiast 10 restoration 3417 photo 7778 news 15293 Land van Cuijk → Boxmeer 861
westermarskoalle.nlWestermarskoalleThe website of Westermarskoalle and Ambion is an information resource for parents, students, and visitors, providing details about the school, its mission, curriculum offerings, events, and contact information.Elementary Schools → Public Elementary Schools 406 Higher Learning → Educational Institutions 1049 student 7623 school 7856 education 13471 event 45199 De Fryske Marren → Joure 689
dierenartsenskarsterlan.nlDierenartsen SkarsterlânDierenartsen Skarsterlân is a veterinary practice dedicated to high-quality animal care, with a focus on the well-being of both animals and their owners.Primary Care → Veterinary Medicine 704 Livestock → Animal Husbandry 1106 vaccination 494 veterinarian 864 animal 2908 practice 9089 care 12338 De Fryske Marren → Sint Nicolaasga 146
wadder.nlWadder.nlThe website Wadder.nl is an information resource about the Wadder, a historical ship, and the Wadder Society.Museums & Collections → Historic Ships 26 Organizations → Society 767 gallery 1983 video 6714 history 7286 Altena → Hank 113
scharsterrijn.nlCooperative Association "Watersportpark Scharsterrijn"Watersportpark Scharsterrijn is a cooperative association providing a recreational area for its members and their guests.Boating → Harbors 252 Sustainability → Cooperatives 970 statutes 73 administrator 161 berth 341 address 901 park 1863 member 10154 De Fryske Marren → Boornzwaag 17
vlaartechniek.nlVlaar TechniekVlaar Techniek is a specialist in automation for water management, offering complete solutions for mills, dams, bridges, and locks.Automation & Control → Automation 1494 Nature Conservation → Water Management 1138 measurement and control technology 15 telemetry 20 water management 260 mill 487 bridge 557 automation 2682 De Fryske Marren → Lemmer 1188
kostenkozijnen.nlkostenkozijnen.nlThe website provides information about the costs of installing frames, including plastic, aluminum, and wooden frames, both inside and outside, including assembly. It also offers the possibility to request quotes and compare prices.Windows → Wooden Windows 52 Windows → Frames 1211 assembly 1733 window 2030 frames 2556 price 8328 quote 12863 Zwartewaterland → Genemuiden 405
loodzwaar-media.nlLoodzwaar MediaLoodzwaar Media is a web design and development agency based in Joure, Friesland, specializing in creating custom websites, webshops, and web applications, as well as online marketing services.Web Design & Development → Digital Marketing 998 partner 4272 marketing 7107 webshop 8648 strategy 9379 De Fryske Marren → Joure 689
hetstammeland.nlMini Camping Het StammelandMini Camping Het Stammeland is a minicamp located in West Friesland offering campers a quiet and comfortable accommodation with views of the Dutch countryside.Camping → Minicamping 246 pitch 332 solar energy 373 sanitary 750 campsite 2093 nature 9094 De Fryske Marren → Lemmer 1188
hdblogistics.nlHdB LogisticsThe website of HdB Logistics describes a logistics service provider specializing in full truck loads (FTL) and less than truckload (LTL) transport, including bulk transport and storage.Logistics → Storage 1170 Transportation Services → Container Transportation 181 bulk 34 storage 2446 logistics 3257 transport 6105 De Fryske Marren → Joure 689
ritafeld.nlRita Feld Personal Funeral CareThe website of Rita Feld Personal Funeral Care offers personal funeral care in West Friesland, providing services such as arranging funerals, offering funeral packages, and advising on various options, including burial, cremation, and memorial services.Family → Funeral Services 2084 funeral arranger 11 memorial service 17 funeral package 19 funeral wishes 56 cremation 615 funeral 2477 De Fryske Marren → Lemmer 1188
westfrieslandbeweegt.nlWest-Friesland BeweegtThe West-Friesland Beweegt website offers movement activities in West-Friesland, focused on promoting an active and healthy lifestyle for all ages and levels.Initiatives & Projects → Local Initiatives 1001 Sports → Group Class 2051 trainer 1966 class 2076 movement 2304 lifestyle 2918 De Fryske Marren → Lemmer 1188
nicolekruyning.nlNicole KruyningThe website of Nicole Kruyning offers professional psychological guidance, training, and workshops focused on processing trauma, loss, and grief, for both individuals and businesses.Pregnancy & Childbirth → Miscarriage 25 loss 740 grief 1577 trauma 2107 workshop 19325 training 28133 De Fryske Marren → Lemmer 1188
crematoriumschagen.nlCrematorium SchagenCrematorium Schagen provides services and facilities for farewells and remembrance, with a focus on personal wishes and a peaceful environment.Funeral Services → Funeral Arrangement 486 Travel → Tourism 3754 bereavement room 13 cremation 615 farewell 1109 wishes 2717 environment 4873 De Fryske Marren → Lemmer 1188
nuovomedia.nlNuovo MediaNuovo Media is an interactive design agency offering services in branding, graphic design, and website development.Design & Creative → Identity 593 online marketing 1085 graphic design 2042 branding 4614 communication 10162 Weststellingwerf → Wolvega 524
delta-impuls.nlDelta ImpulsThe website of Delta Impuls is an information source about the table tennis club with locations in Heerenveen, Joure and Steenwijk. It provides details about the club, members, competitions, training sessions, opening hours, events, and contact information.Sports Clubs → Table Tennis 495 table tennis club 81 competition 4759 membership 10442 news 15293 training 28133 De Fryske Marren → Joure 689
sea-life.nlHomarium.nl / Sea-life.nlHomarium.nl is a Dutch website selling clear, glass-based living systems for shellfish and crustaceans, targeting restaurants, fish shops, and seafood wholesalers.Hobbies → Aquariums 248 Restaurants & Dining → Seafood Restaurants 612 filter system 24 aquarium 320 glass 2919 restaurant 11215 De Fryske Marren → Lemmer 1188
schilstra-itsolutions.nlSchilstra IT SolutionsThe website of Schilstra IT Solutions showcases customized IT services focused on the municipality of the Fryske Marren, with a focus on security systems, WiFi solutions and repairing existing IT equipment.IT → Network Solutions 45 it services 130 security system 212 wifi 1372 software 8291 repair 14576
ronaldzingt.nlRonald VisserThe website Ronald Zingt offers singing workshops and singing sessions, primarily in Zwolle and Echten, aimed at stimulating the feeling of connection and unlocking the musical potential of participants.Education & Training → Singing 878 Institutions → Cultural Centers 610 livestream 478 dream 883 singing 1056 agenda 4374 De Fryske Marren → Echten 54
owfvenhuizen.nlRiding Association LR/PC Oostelijk West-Friesland VenhuizenThe website of Riding Association LR/PC Oostelijk West-Friesland Venhuizen provides information about the association, its activities, events, and membership opportunities.Equestrian → Riding Clubs 245 Equestrian → Stables 629 pony 409 stable 768 clinic 1079 horse 4337 competition 4759 membership 10442 Drechterland → Venhuizen 154
typehelden.nlTypeheldenThe website offers online typing courses, focused on quickly learning to type blind with group learning.Knowledge → Education 69666 exam 2120 teacher 2890 software 8291 course 14728 De Fryske Marren → Joure 689
budgetvoordeelmakelaar.nlBudget Voordeel MakelaarThe website of Budget Voordeel Makelaar provides an overview of available properties for sale in various regions, including Lelystad, Almere, Dronten and Muiden. It offers potential buyers the opportunity to view properties and filter them based on location, price, size and other features.House Types → Houses 2546 Real Estate → Property Search & Listings 506 filter 487 agent 1253 property 7406 price 8328 De Fryske Marren → Echtenerbrug 24
flowadviesburo.nlFlow advice bureauFlow advice bureau offers HR advice and career guidance focused on workplace happiness.Human Resources → Absence Management 850 Recruitment → HR Services 3384 absence management 40 workplace happiness 85 study guidance 90 career counseling 145 hr 884 De Fryske Marren → Lemmer 1188
kjk-grohan.nlKJK Grondverzet, Bestrating, Tuinaanleg, HandelsondernemingKJK is a groundwork, paving, and trading company that performs various garden and paving projects in various locations.Garden → Paving 1003 Land Development & Earthworks → Stabilization 49 driveway 93 groundwork 1348 fence 1814 paving 1942 terrace 4847 garden 13129 Opsterland → Lippenhuizen 41
preventie-werk.nlPreventie&WerkPreventie&Werk is an independent occupational health and accident prevention specialist dedicated to helping organizations structurally reduce absenteeism.Occupational Medicine → Occupational Health Services 60 Insurance & Risk → Risk Management 1060 arbo 155 absenteeism 461 risk 2896 training 28133 De Fryske Marren → Joure 689
wogmeer.nlVereniging Oud WogmeerThe website of Wogmeer presents the history and character of this village in West Friesland, North Holland, with an emphasis on its agricultural history and associated culture.Local Communities → Villages 1005 Landscape → Polders 212 chronicle 25 photographs 254 polder 476 village 808 family 6462 De Fryske Marren → Lemmer 1188
desuskes.nlDe SuskesThe website provides information about the musical formation De Suskes, including their schedule, bookings, and contact information.Live Music → Cover Bands 433 Popular → Dance Music 234 bookings 523 schedule 2624 band 2977 performance 7586 music 13170 event 45199 Steenwijkerland → Belt-Schutsloot 29
loesbotman.nlLoes BotmanThe website of Loes Botman offers for sale artistic pastel drawings, provides online workshops for learning to draw with pastel crayons, and accepts commissions for creating pastel drawings.Visual Arts → Drawing 1046 pastel 99 commission 609 drawing 1101 online shop 1310 workshop 19325 De Fryske Marren → Echten 54
dwangburchten.nlBen DijkhuisThis website presents information about the medieval fortified castles of West Friesland and Alkmaar, as well as other significant medieval objects in the region. It provides historical background information and visualizations.Local History → Dutch History 1067 castle 494 restoration 3417 article 6000 De Fryske Marren → Lemmer 1188
jazzenzo.nlJazzenzoThe Jazzenzo website is a platform for news, reviews, and archives related to jazz music, with a focus on Dutch and international jazz artists and events.Genres → Jazz 989 jazz 393 composer 412 album 1495 festival 3804 concert 4409 article 6000 De Fryske Marren → Lemmer 1188
burgemeesters.nlThe Dutch Association of MayorsThe Dutch Association of Mayors (NGB) is a professional association representing Dutch mayors and authorities, providing information and services to its members.Local Government → Village Council 479 local government 12 mayor 102 publication 2018 board 3438 training 28133 Nuenen ca → Nuenen 102
kameleonterherne.nlKameleon TerherneKameleon Terherne is a recreation business that offers day trips, school trips and group activities, with a focus on the stories surrounding the Kameleon characters.Water → Boating 1592 Primary & Secondary Schooling → School Activities 39 boat tour 94 farm 2622
museumjoure.nlMuseum JoureMuseum Joure is a surprising maker’s museum that showcases the history of Douwe Egberts and other local crafts in Joure.Museums → Historical Museums 341 clocks 178 café 944 exhibition 5332 De Fryske Marren → Joure 689
dedalfsermarskramer.nlDalfser MarskramerThe Dalfser Marskramer is a local news website reporting news and events from the region of Salland and surrounding municipalities.Associations → Rotary 62 News & Journalism → Regional News 948 clothing bank 38 runner 126 municipality 6837 news 15293 event 45199 Raalte → Luttenberg 532
archeologiewestfriesland.nlArcheologie West-FrieslandArcheologie West-Friesland is an organization dedicated to protecting, researching, and preserving archaeological remains found in West-Friesland.Museums & Collections → Archaeology 291 Context 161394 finds 68 archaeology 256 excavation 382 publication 2018 Texel → Den Burg 184
sybrandys.nlSybrandys SpeelparkSybrandys Speelpark is a family-friendly amusement park in the Netherlands that has been operating for over 50 years, offering a variety of attractions and play equipment.Family Fun → Family Activities 1493 birthday party 223 playground 1088 attraction 1275 parking 1928 ticket 2785 package 6112 De Fryske Marren → Oudemirdum 73
mijninschrijving.nlEventTimerThe website mijnINSCHRIJVING.nl is a platform for registering and managing participation in various running and sporting events, such as races and triathlons.Running → Running Events 684 Web → Websites 2028 terms and conditions 118 organizer 167 participant 1934 results 3954 registration 4366 event 45199 De Fryske Marren → Balk 224
natuurkaart.nlNatuurkaart.nlNatuurkaart.nl is a website providing information and accommodations for nature lovers seeking vacations in the Dutch countryside.Landscape → Dutch Landscapes 41 Vacations → Nature Vacations 269 nature area 497 landscape 2609 holiday home 2753 relaxation 3968 accommodation 4921 Smallingerland → Drachten 2052
bmf.nlBibliotheken Mar en FeanThe website of Bibliotheken Mar en Fean provides information about the local libraries, their services, activities, membership terms, and events.Libraries → Local Libraries 75 Family → Children 2798 library 988 podcast 3328 membership 10442 book 11396 De Fryske Marren → Lemmer 1188
dnodoen.nldnoDoendnoDoen is an organization that assists vulnerable people with guidance, accommodation, and residential support, primarily in North Holland.Social Services → Community Services 162 Palliative & End-Of-Life Care → Long-Term Care 112 residential support 14 facility 2616 accommodation 4921 region 5412 De Fryske Marren → Lemmer 1188
bloklugthart.nlBlokLugthartThe website showcases a collection of public art installations and sculptures located throughout the Netherlands.Sculpture → Visual Arts 4165 public space 137 sculpture 1440 artwork 2248 installation 13742 Westerwolde → Ter Apel 345
valkenklasse.nlValkenklasse OrganisationThe website of the Valkenklasse Organisation provides information, news, and a platform for falconry sailors and their associations.Sailing → Competitive Sailing 17 Animals → Pets 1382 photo 7778 membership 10442 news 15293 Bodegraven-Reeuwijk → Reeuwijk 531
agrarischeschouwjoure.nlWefabricThe Agrarische Schouw Joure is a Northern Trade Fair held annually in September, focused on the agricultural sector.Business & Professional → Trade Shows 951 floor plan 394 fair 583 sponsors 2642 De Fryske Marren → Joure 689
volgermeer.nlVolgermeer VerenigingThis website, run by the Volgermeer Vereniging and Stichting Burgerkomitee Volgermeer, provides information about the Volgermeerpolder, a historically polluted area in Waterland that has been remediated and is now accessible as a natural area.Nature → Protected Areas 18 Environment → Environmental Issues 85 remediation 143 natural area 208 association 8562 research 8967 De Fryske Marren → Broek 21
meulen.nlVan der Meulen Edelmetaal B.V.Van der Meulen Edelmetaal B.V. is a specialist company focused on the recycling of precious metals and related services.Investing → Precious Metals 326 Waste Management → Recycling 1027 precious metal 78 trade 553 recycling 1036 analysis 1615 De Fryske Marren → Joure 689
vvdwp.nlvv DWP 'De Wite Peal'The website of vv DWP 'De Wite Peal' provides information about the football club, including its history, events, members, and volunteer opportunities.Sports Clubs → Football Clubs 467 club magazine 49 football club 603 match 3471 volunteer 8367 member 10154 De Fryske Marren →  Rotsterhaule 19
svnok.nlSV NOKThe website of SV NOK provides information about the various sports offered by the club, including volleyball, tennis, soccer, and gymnastics, and offers an overview of the club's activities and structure.Team Sports → Volleyball 842 Youth → Soccer 254 soccer 92 department 269 gymnastics 502 volleyball 617 tennis 836 board 3438 De Fryske Marren → Oudemirdum 73
vaarkaartfriesemeren.nlStentec SoftwareThe Vaarkaart Friese Meren is a free digital waterway chart providing navigation information for watersports activities in the Friesian Lakes.Water → Boating 1592 Software Development & Engineering → Software 11608 chart 106 navigation 330 watersport 540 device 698 Southwest-Friesland → Heeg 227
boerbart.nlBoer BartThe website of Boer Bart is a farm, restaurant, and local shop offering a family-friendly environment and organic products, emphasizing taste, craftsmanship, and relaxation.Event & Party Venues → Farm Restaurants 31 Sustainable Practices → Farming 138 organic farming 25 play area 173 farm 2622 family 6462 restaurant 11215
haskeroord.nlProtestantse Gemeente HaskeroordThe website of the Protestant Church of Haskeroord presents information about the faith community and its activities in the villages of Haskerhorne, Oudehaske and Vegelinsoord. It provides news, an agenda, church services, and information about diaconal and pastoral activities.Local Communities → Village Communities 121 Religion → Protestantism 3178 pastoral 49 diaconate 182 date 1112 church 3439 De Fryske Marren → Haskerhorne 14
johannesbeers.nlJohannes BeersBeersBlog is a blog and genealogical website documenting the history of the Beers and Van der Pal family names, including pedigree research, regional history, and Frisian culture.Social Sciences → Genealogy & Family History 1403 frisian 35 pedigree 232 genealogy 543 ship 5103 family 6462 history 7286 De Fryske Marren → Lemmer 1188
natuurwegwijzer.nlNorth Holland ProvinceNatuurwegwijzer is a website that recommends excursions and routes in the nature of North Holland.Cycling → Cycling Routes 1002 TravelContent → Travel Guides 938 ranger 11 natural area 208 map 801 parking 1928 route 3425 Den Helder → Guldemond 42
oudemirdum.nlPlaatselijk Belang OudemirdumThe website of Oudemirdum/Aldemardum provides information about the village, events, local news, and history, with a focus on recreation and the community.Village Council → Local Councils 21 Local Communities → Villages 1005 brink 44 history 7286 community 7931 news 15293 event 45199 De Fryske Marren → Oudemirdum 73
visitlangweer.nlAssociation for the Promotion of LangweerThe Visit Langweer website is a promotional and information platform for the village of Langweer in Friesland, Netherlands, focusing on tourism and local businesses.Local Communities → Villages 1005 Nature → Nature Reserves 1032 tourism 303 watersport 540 sail 965 camp 2466 restaurant 11215 event 45199 De Fryske Marren → Langweer 93
skbl.nlStichting Kastelen, (historische) Buitenplaatsen en Landgoederen (sKBL)The Stichting Kastelen, (historical) Country Estates and Manors (sKBL) aims to increase the visibility of beautiful KBL and encourage engagement from various groups.Nature → Estates 771 Monuments → Heritage 526 cooperation 433 heritage 818 estate 1099 volunteer 8367 Almelo → Schelfhorst 28
lemsternijs.nlLemsternijsThe website Lemsternijs is a local news and information source for the municipality of Lemmer and surrounding areas, covering topics ranging from local events and job postings to news, advertisements, and business stories.News & Journalism → Local News 488 job postings 676 weather 817 advertisement 1707 news 15293 event 45199 De Fryske Marren → Echtenerbrug 24
nyeskou.nlTheeschenkerij Nije SkouThe website of Theeschenkerij Nije Skou presents the history, current ferry service, and tea house in the area around Nije Skou, Skarsterlân.Water → Rivers 180 Water Transportation → Ferries 129 tea house 73 ferry 179 tourism 303 foundation 6678 history 7286 De Fryske Marren → Joure 689
wikel.nlGemeente Balk en WaarderlandThis website serves as an informative village website for residents and visitors, providing news, an agenda, historical information, recreational opportunities, and contact details.Protestant Churches → Church Buildings 69 church 3439 agenda 4374 news 15293 Amsterdam → Sloten 146
ulepanne.nlDe UlepanneThe website of De Ulepanne is a sailing school that offers sailing courses, boat rentals, and accommodation to adults, youth, and families.Sailing → Sailing Schools 70 sailing school 39 boat 2980 arrangement 3104 accommodation 4921 course 14728 De Fryske Marren → Balk 224
glemmerbeach.nlWebwercktGlemmer Beach is a beach festival held annually in Lemmer, Friesland, focused on providing a fun and enjoyable experience with music, food trucks and artists.Festivals → Music Festivals 1020 Beach Life → Beach 532 foodtrucks 182 coziness 235 festival 3804 artist 5745 music 13170 De Fryske Marren → Lemmer 1188
taaipop.nlStichting Taaipop LutjebroekThe website of Taaipop 2025 presents information about the annual indoor festival Taaipop, which will take place on April 5, 2025, at Café de Paus in Lutjebroek.Festivals → Music Festivals 1020 youth work 171 festival 3804 atmosphere 5591 volunteer 8367 music 13170 De Fryske Marren → Lemmer 1188
bregepop.nlBrêgepop FestivalThe Brêgepop Festival is a festival that takes place in April and marks the beginning of the festival season. The tenth edition takes place in 2025 and offers a diverse line-up of more than 60 artists across 8 stages.Festivals → Music Festivals 1020 bus transportation 13 lineup 267 ticket 2785 festival 3804 De Fryske Marren → Scharsterbrug 16
balkvooruit.nlPlaatselijk Belang Balk VooruitThe website of Plaatselijk Belang Balk Vooruit provides information about the town of Balk and keeps residents updated on local developments and activities within the community.Village Organizations → Local Interests 13 De Fryske Marren → Balk 224
joure.nlVisit JoureThe Visit Joure website presents the town of Joure, Friesland, and highlights the unique atmosphere and history of the town, particularly the hospitality and relaxed ambiance stemming from its trading past.Local & Regional Focus → Local Businesses 1077 Places → Towns 380 trade 553 hospitality 3491 history 7286 event 45199 De Fryske Marren → Joure 689
harich.nlHarichThe website of Harich provides information about the village of Harich, located in the Fryske Marren, including its history, governance, associations, events, and local monuments.Local Communities → Villages 1005 Village Focus → Village Organizations 683 governance 610 village 808 farm 2622 church 3439 history 7286 event 45199 De Fryske Marren → Balk 224
regio-westfriesland.nlregio-westfriesland.nlThe website provides tips, inspiration, and advice for discovering the region of West Friesland, focusing on holiday activities and attractions.Context 161394 town 126 attraction 1275 cycle 1906 vacation 4234 nature 9094 De Fryske Marren → Lemmer 1188
rottumonline.nlRottum OnlineThe website Rottum Online serves as an information center for the village of Rottum, providing news, agendas, village interests, contact information, and other relevant information for residents and visitors.Local Communities → Village Communities 121 Landscape → Nature Areas 58 nature area 497 village 808 agenda 4374 municipality 6837 news 15293 Het Hogeland → Rottum 38
kanoroutes.nlJohans Kayak SiteThe website provides information about tourist kayaking routes in the Netherlands and abroad.Water Sports → Kayaking 51 Planning → Tours 870 kayak 104 netherlands 1376 trip 2032 Altena → Werkendam 399
friesetuigpaard.nlVereniging Het Friese TuigpaardThe website of Vereniging Het Friese Tuigpaard provides recent news, upcoming competitions and results of events related to the Friesian Draft Horse.Equestrian → Riding Clubs 245 results 3954 competition 4759 news 15293 Opsterland → Wijnjewoude 86
natuurlijkwandelen.nlNatuurlijk WandelenThe website provides an overview of various walking routes in Dutch nature, primarily in Friesland and Overijssel.Nature → Nature Reserves 1032 Activities → Excursions 257 bog 11 nature reserve 339 walking route 340 landscape 2609 route 3425 Southwest-Friesland → Raerd 15
ebenhaezer-meilan.nlCBO MeilânThe website of CBO Meilân presents information about its Christian primary schools and communal living schools, primarily located in Heerenveen and De Fryske Marren, and describes the educational approach focused on the personal development of children.Childcare → Preschool Groups 76 Primary Education → Christian Education 446 preschool 495 student 7623 school 7856 education 13471 Friesland → Heerenveen 2578
bakhuizen.nlBakhuizen, Mirns & RijsThe website of Bakhuizen, Mirns & Rijs provides information about the villages of Bakhuizen and Mirns, their history, local events, and the activities of Dorpsbelang BMR, an organization committed to sustainability and community development.Local Communities → Villages 1005 Village Focus → Village Life 262 dorpsbelang 12 village 808 history 7286 sustainability 18451 event 45199 De Fryske Marren → Bakhuizen 45
bloei-meilan.nlCBO MeilânThe website of Bloei, a branch of CBO Meilân, provides information about its 13 Christian primary schools and 2 co-living schools located in Heerenveen and De Fryske Marren. It offers details on schools, education, parental involvement, and the unique approach of the co-living schools.Elementary Schools → Christian Primary Schools 342 parent 4318 student 7623 school 7856 community 7931 education 13471 Friesland → Heerenveen 2578
nederlandsefierljepbond.nlDutch Fierljepping Association (NFB)The website serves as a central information source about fierce jumping (fierljeppen) in the Netherlands, including records, rankings, tournament overviews, and regulations. It also aims to support the Dutch Fierljepping Association (NFB).Extreme Activity → Extreme Sports 60 rankings 44 record 1098 tournament 2476 association 8562 Southwest-Friesland → IJlst 157
briozeilmarathon.nlOnder OnsThe website provides information about the annual Brio Zeilmarathon sailing competition held in Terherne.Sailing → Racing Sailing 22 Football → Competitions 1072 marathon 192 sail 965 boat 2980 results 3954 De Fryske Marren → Terherne 98
molkwarderkoeke.nlBakkerij Molkwar BVThe website of Molkwarder Koeke describes the family-run business that produces traditional Dutch pastries, with a focus on Friesland’s baking history and tradition.Bakery & Food Production → Artisan Bakeries 77 friesland 692 bakery 718 pastries 946 recipe 5142 De Fryske Marren → Joure 689
vvheeg.nlVoetbalvereniging HeegThe website of Voetbalvereniging Heeg provides information about the club, its history, teams, events, and activities.Sports Clubs → Local Sports Clubs 248 football club 603 sponsors 2642 youth 3126 match 3471 event 45199 De Fryske Marren → Balk 224
adel.nlAdriaan de LangeThis website provides information about the Dutch nobility.Museums & Collections → National History 50 Social Sciences → Genealogy & Family History 1403 family 6462 history 7286 De Fryske Marren → Lemmer 1188
kerklangweer.nlProtestantse Gemeente LangweerThis website provides information about the Protestantse Gemeente Langweer, the village of Langweer, church services, activities, and the history of the church and village.Local Communities → Villages 1005 Protestantism → Protestant Church Associations 33 bulletin 54 organ 633 church service 879 history 7286 community 7931 event 45199 De Fryske Marren → Langweer 93
debuorkerij-terherne.nlStichting Dorpshuis De BuorkerijThe Buorkerij is a village house that provides a public meeting place for residents of Terherne and the surrounding area, focused on connection and relaxation.Entertainment → Leisure Activities 338 Village Focus → Village Houses 214 village house 165 farmhouse 878 space 3846 renovation 13849 De Fryske Marren → Terherne 98
dgstiens.nlDoopsgezinde Gemeente StiensThe Doopsgezinde Gemeente Stiens is an open community offering a welcoming environment for all ages, emphasizing enthusiasm, commitment, and engagement.Local Communities → Religious Communities 270 Protestantism → Mennonite 23 agenda 4374 community 7931 news 15293 Steenwijkerland → Giethoorn 565
jutrijp-hommerts.nlDoarpsbelang Jutrijp-HommertsDoarpsbelang Jutrijp-Hommerts is a website providing information and news about the villages of Jutrijp and Hommerts in the Súdwest-Fryslân municipality.Village Council → Local Councils 21 Local Communities → Villages 1005 editorial 162 village house 165 village 808 municipality 6837 association 8562 news 15293 De Fryske Marren → Lemmer 1188
obsakkrum.nlOBS AkkrumOBS Akkrum is a public primary school that focuses on developing critical and creative thinking, collaboration, and problem-solving skills in children within a safe environment.Early Years → Parent Involvement 172 Arts & Culture → Social Education 33 environment 4873 school 7856 child 11566 education 13471 collaboration 16036 Heerenveen → Akkrum 246
de-feanhoop.nlMunicipality of SmallingerlandThe website of De Veenhoop serves as a village website, providing information about the history, tourist attractions, local events, and governance of the village.Historical Sites → Monuments 1027 Local Communities → Villages 1005 skûtsjesilen 17 nature area 497 monument 1168 Leeuwarden → Warten 81
feankleaster.nlStichting VeenkloosterThe website of Stichting Veenklooster provides information about the village of Veenklooster (Feankleaster) in Noardeast-Fryslân, detailing its history, activities, events, and a jubilee year.Historical Sites → Monasteries 65 Local Communities → Villages 1005 stichting 481 book 11396 event 45199 De Fryske Marren → Terkaple 24
obstswannestee.nlOBS 't SwannesteeOBS ‘t Swannestee is a modern primary school located in the watersports village of Langweer, dedicated to providing a pleasant and successful learning environment for children.Elementary Schools → Public Elementary Schools 406 Local Communities → Villages 1005 respect 254 reading 784 space 3846 school 7856 education 13471 De Fryske Marren → Langweer 93
heaksenkrekt.nlHeaks and KrektThe website of Heaks and Krekt presents information about club activities, competition results, and other relevant news articles.Walking → Walking Competitions 182 Team → Team Sports 2401 sponsors 2642 results 3954 agenda 4374 competition 4759 photo 7778 association 8562 De Fryske Marren → Balk 224
bronstijdwestfriesland.nlBronstijd West-FrieslandBronstijdWestFriesland.nl is a website that provides information and tips about animals in West-Friesland, including care tips and nutritional advice.Domestic Animals → Dogs 11 Animals → Horses 1455 litter box 40 nutritional supplements 68 horse feed 83 sheep 274 dog 5483 De Fryske Marren → Lemmer 1188
hegegerzen.nlDe Hege GerzenThe website of De Hege Gerzen presents a beach pavilion and recreation area located on the IJsselmeer in Oudemirdum, offering activities and facilities for recreation, parties, and outings.Beach → Beach Pavilions 162 Event & Party Venues → Beach Restaurants 210 beach pavilion 102 recreation 799 beach 3210 terrace 4847 party 5928 De Fryske Marren → Oudemirdum 73
jouwjoure.nlN.V.The website 'YourJoure' is an information and community platform for the residents of Joure, managed by residents of Joure.Initiatives & Collaboration → Initiatives 459 Blogs & Publications → Regional 272 market 2772 festival 3804 photo 7778 event 45199 De Fryske Marren → Joure 689
sloeproeien.nlFederation of Dutch Sloep RowersThe website sloeproeienNL is an online community for (sloep) rowers.Water Sports → Rowing 303 Internet → Forums & Communities 1599 sloep 127 rowing 243 database 1153 calendar 1556 competition 4759 association 8562 Zwartewaterland → Zwartsluis 228
westersypen.nlStichting WestersypenWoonzorgvoorziening Westersypen Scharsterbrug provides housing, care, and services for individuals with dementia.Neurology → Dementia 509 Care → Residential Care 305 dementia 674 resident 3245 staff 3405 housing 4378 environment 4873 care 12338 De Fryske Marren → Scharsterbrug 16
mooifriesland.nlMooi FrieslandThis website aims to present and promote the province of Friesland, located in the northern part of the Netherlands, in a new way.Accommodation → Bungalow Parks 931 Tourism → Tourist Information 124 tourist 58 natural area 208 friesland 692 restaurant 11215 Waadhoeke → Tzummarum 58
kippenburg.nlLandhuis KippenburgThe website of Landhuis Kippenburg offers information and booking options for renting the estate in Gaasterland for stays of up to 18 people, particularly for events such as company training or family reunions.Conferences & Meetings → Corporate Events 2472 Tourism → Regional Tourism 242 surroundings 463 rent 981 estate 1099 event 45199 De Fryske Marren → Balk 224
gaasterlandinwo2.nlHWGThe website ‘Gaasterland in the Second World War’ is a memorial dedicated to the events and victims of the Second World War in the municipality of Gaasterland, Netherlands.World War II → Remembrance 120 Outdoor → Memorials 269 resistance fighter 17 victim 223 person 448 monument 1168 event 45199 De Fryske Marren → Oudemirdum 73
novmuseum.nlNOV MuseumThe National Public Transport Museum in Ouwsterhaule provides information and arrangements related to public transport and the history of buses in Friesland.Museums → Regional Museums 390 History → Social Sciences 10786 time travel 17 bus 894 museum 2002 restoration 3417 event 45199
oudlemmer.nlStichting Oud LemmerThe Stichting Oud Lemmer website presents photos, stories, and factual information about the history and surroundings of Lemmer, Friesland.History → Historical Events 205 News & Journalism → Regional News 948 De Fryske Marren → Balk 224
geschiedenisgaasterland.nlStichting Histoarysk Wurkferbân Gaasterlân (HWG)The website of Stichting Histoarysk Wurkferbân Gaasterlân (HWG) aims to document and present the history of the Gaasterland region, in Friesland.Periodical Publications → Magazines 1001 Tourism → Regional Tourism 242 magazine 2182 region 5412 history 7286 De Fryske Marren → Harich 35
sanfurd.nlStichting SânfurdThe website of Stichting Sânfurd presents information about the village of Sandfirden, located on a peninsula in the Frisian lakes, and keeps visitors informed about events, church services, and cultural activities.Protestant Churches → Church Services 29 Social Issues → Humanitarian Aid 621 stichting 481 donor 757 church 3439 wedding 4258 event 45199 Southwest-Friesland → Sandfirden 13
westfriesefamilies.nlStichting Westfriese FamiliesThe website of Stichting Westfriese Families is a resource for genealogical research focused on families with roots in West-Friesland.Foundations → Cultural Foundations 101 History → Social Sciences 10786 west-friesland 41 genealogy 543 library 988 magazine 2182 family 6462 research 8967 De Fryske Marren → Lemmer 1188
kerkpagina.nlKerkpaginaThis website is a portal for finding churches in the area and provides information about the church communities.Religion → Protestant Church in The Netherlands 16 search function 273 map 801 church 3439 account 5781 news 15293 Schagen → Burgerbrug 29
oaters.nlBV Oaters Basketbal Vereniging JoureBV Oaters Basketbal Vereniging Joure is a basketball club welcoming members of all ages and organizing matches.Team Sports → Basketball 244 Youth Development → Youth 1033 basketball club 49 match 3471 member 10154 news 15293 coach 25810 De Fryske Marren → Joure 689
vriendenhvbkerk.nlFriends of the Hobbe van Baerdt ChurchThe website of the Friends of the Hobbe van Baerdt Church provides information about upcoming events and activities organized by the group.Music → Classical Music 1015 Theater → Performances 649 accordion 165 sinterklaas 456 organ 633 concert 4409 De Fryske Marren → Goingarijp 86
historiejoure.nlHistory Working Group JoureThe website of the History Working Group Joure serves as a repository and presentation platform for information about the history of the municipality of Skarsterlân, specifically the former municipality of Joure. The aim is to collect stories, photos, and documentation from residents and to publish them.Institutions → Historical Associations 421 Visual Arts → Museums 2049 visual material 38 documentation 452 archive 2067 history 7286 story 8285 De Fryske Marren → Joure 689
pb-ouwstertrijegeaen.nlPlaatselijk Belang Ouwster-TrijegeaënThe website of Plaatselijk Belang Ouwster-Trijegeaën provides information about the livability, news, associations, and activities in the three villages of Ouwster-Nijega, Oldeouwer, and Ouwsterhaule.Local Government → Village Council 479 Village Focus → Village Organizations 683 village 808 photo 7778 association 8562 news 15293
wijkraadslangenbeek.nlWijkraad SlangenbeekThis website provides information about the Slangenbeek district in Hengelo, including its history, projects, news, and contact details.Local Government → Village Council 479 Neighborhood Focus → Neighborhoods 1028 neighborhood council 80 population 102 resident 3245 construction 7421 house 8121 De Fryske Marren → Broek 21
riedo.nlMunicipality of SondelThe website ‘Historical and Latest News from Sondel’ provides information about the village’s history, current events, and local amenities of the village of Sondel.Local Communities → Villages 1005 News & Journalism → Local News 488 community center 442 museum 2002 church 3439 history 7286 event 45199 De Fryske Marren → Sondel 14
skutsje.nlSkutsje.nlSkutsje.nl is an online platform providing news and information about skûtsjesilen, a traditional sailing race in Friesland, with a focus on the SKS (Sint-Katarina Sailing Series) and IFKS (International Friesian Kortschuit Championship).Sailing → Traditional Sailing 19 skûtsje 57 newspaper 396 sail 965 news 15293 De Fryske Marren → Lemmer 1188
vvdelfstrahuizen.nlVV DelfstrahuizenThe website of VV Delfstrahuizen provides information for members and interested parties about the football club, including club information, teams, news, and photos.Sports Clubs → Local Sports Clubs 248 football club 603 photo album 686 match 3471 membership 10442 news 15293 De Fryske Marren → Delfstrahuizen 47
dewalde.nlVoetbalvereniging De WâldeVoetbalvereniging De Wâlde is a Dutch football association based in Friesland, offering information and events to its members and potential players.Football → Amateur Football 757 Sports Associations → Football Associations 42 football association 129 match 3471 news 15293 De Fryske Marren → Balk 224
wfhc.nlWFHC HoornThe website of WFHC Hoorn provides information about the hockey club, including youth programs, competitive teams, events, and membership details, and serves as a platform for news, photos, and contact.Hockey → Hockey Clubs 118 hockey 348 schedule 2624 youth 3126 webshop 8648 membership 10442 De Fryske Marren → Lemmer 1188
joodsekinderen.nlTresoarThe website provides information about the ‘Return of the Jewish Children’ project, which highlights the rescue of Jewish children during the Second World War in Friesland and details the later lives of these wartime sheltered children.World War II → Resistance 78 Personal → Biography 1003 friesland 692 documentary 1081 podcast 3328 De Fryske Marren → Lemmer 1188
detrieme-meilan.nlDe TriemeThe website of De Trieme and CBO Meilân presents information about two schools focused on helping children discover themselves and providing a safe and stimulating learning environment.Elementary Schools → Christian Primary Schools 342 Community → Social Issues & Welfare 28159 discovery 153 theme 4015 school 7856 child 11566 education 13471 collaboration 16036 Friesland → Heerenveen 2578
duikmuseum.nlDuikmuseum LemmerThe Duikmuseum Lemmer is a museum in Lemmer that presents a collection of historical diving equipment for true diving enthusiasts by appointment.Toys → Construction Toys 12 Water Activity → Diving 505 diving equipment 79 timeline 149 museum 2002 De Fryske Marren → Lemmer 1188
scjoure.nlSportclub JoureSportclub Joure is an omni-sports association focused on football and korfbal, providing information and services for members and the community.Sports Associations → Dutch Sports Associations 53 Sports Activities → Football 4144 korfbal 182 football 1347 sponsorship 2686 membership 10442 news 15293 event 45199 De Fryske Marren → Joure 689
depaedwizer-meilan.nlCBO MeilânThe Paedwizer is a school that helps children discover themselves and confidently navigate the world.Elementary Schools → Christian Primary Schools 342 principle 138 director 716 student 7623 school 7856 Friesland → Heerenveen 2578
despoarsiker-meilan.nlP.C.B.S. “De Spoarsiker” and CBO MeilânThe website of P.C.B.S. "De Spoarsiker" primary school Echtenerbrug and CBO Meilân presents information about the schools, their policies, school guides, activities, and contact details, aiming to inform and involve parents, students, and other stakeholders.Government & Administration → Local Municipalities 219 Primary & Secondary Schooling → Primary Education 5094 portfolio 6854 school 7856 De Fryske Marren → Echtenerbrug 24
ges.nlWatersport Boulevard 't GesWatersport Boulevard 't Ges in Sneek is a business park that brings together various watersport and related businesses, providing watersports enthusiasts with a central location for their needs.Corporate Events → Corporate Outings 878 Water Activity → Water Sports 2944 sneekermeer 14 horeca 115 watersport 540 yacht 647 museum 2002 De Fryske Marren → Goingarijp 86
sjinkieknegt.nlSjinkie KnegtThe website presents biographical information, achievements, and news related to Sjinkie Knegt's career as a shorttracker.Winter Sports → Skating 841 Personal → Biography 1003 shorttrack 12 skating 314 biography 697 club 4225 competition 4759 training 28133 Heerenveen → De Zanden 29
vvoudehaske.nlv.v. OudehaskeThe website of v.v. Oudehaske provides information about the amateur football club, including its teams, news, club structure, and contact details.Amateur Football → Club Websites 57 football club 603 sponsorship 2686 club 4225 competition 4759 news 15293 De Fryske Marren → Oudehaske 49
allegorischeoptocht.nlVVV St. NicolaasgaThe website of VVV St. Nicolaasga provides information about the annual Allegorical Optocht (parade), an event that marks the beginning of three days of festivities in the village of St. Nicolaasga.Carnival → Parades 76 Local Events → Village Festivals 219 parade 513 facebook 850 archive 2067 ticket 2785 De Fryske Marren → Sint Nicolaasga 146
mhclemmer.nlMHC LemmerThe website of MHC Lemmer serves as an information hub for the hockey association, providing details about events, teams, membership, and contact information.Associations → Sports Associations 1082 hockey 348 sponsorship 2686 match 3471 membership 10442 news 15293 training 28133 De Fryske Marren → Lemmer 1188
vriendenvanhetflevopark.nlFriends of the FlevoparkThe website of Friends of the Flevopark informs visitors about the protection of the park against flooding and the activities of the organization.Local Politics → Political Parties 898 Parks → Urban Parks 29 waterboard 18 dike 148 park 1863 tree 1879 De Fryske Marren → Lemmer 1188
dewerfjoure.nlWoon-zorgcomplex De WerfThe website for Woon-zorgcomplex De Werf in Joure provides information about the development of a new, sustainable living and care complex with a health center, apartments, and a community center.Apartment Living → Complexes 26 Senior & Assisted Living → Assisted Living 65 care provider 100 living 578 apartment 5088 construction 7421 De Fryske Marren → Joure 689
ffs-vegelinsoord.nlFuotbal Foriening Stobbegea - FFSThe website of Fuotbal Foriening Stobbegea (FFS) serves as an information hub for members, supporters, and the community regarding the football club.Football → Local Football Clubs 14 football club 603 member 10154 news 15293 coach 25810
pkn-ons.nlPKN ONSThis website of PKN ONS provides information about the activities, church services, working groups, and financial data of the Protestant-Catholic Dutch Church (PKN) in Sondel, including the church in De Haven.Protestantism → Reformed 1323 Protestantism → Churches 1009 church buildings 21 pastor 208 church service 879 archive 2067 De Fryske Marren → Sondel 14
rkvvbakhuizen.nlRKVV BakhuizenThe website of RKVV Bakhuizen provides information about the football club, including membership, news, sports news, youth teams, seniors and club policies.Clubs → General Information 12 club news 22 youth team 102 football club 603 webshop 8648 membership 10442 De Fryske Marren → Bakhuizen 45
dorphauwert.nlMunicipality of MedemblikThis website provides information about the various associations, agendas and minutes of the village of Hauwert, and offers a description of the location of the village and its history.Local Communities → Villages 1005 Protestantism → Churches 1009 minutes 169 agenda 4374 association 8562 De Fryske Marren → Lemmer 1188
grsv.nlGRSVThe website of the GRSV (Sloeproei Vereniging Zonnig Grou) provides information about the association, its activities such as competitions and training sessions, and introduces the sloeps used by the teams.Water Sports → Rowing 303 Associations → Sports Associations 1082 sloep 127 association 8562 De Fryske Marren → Terherne 98
keatling.nlOSCOMThe website for Keatling is an online resource providing information about the vocal group Keatling, including their history, members, repertoire, schedule, and recent performances.Theater → Performances 649 vocal group 50 guestbook 338 song 1285 repertoire 2497 schedule 2624 De Fryske Marren → Joure 689
pb-sintnyk.nlPlaatselijk Belang Sint NicolaasgaPlaatselijk Belang Sint Nicolaasga is an organization dedicated to representing the interests of the residents of Sint Nicolaasga and its surrounding area.Local Government → Village Council 479 Village Focus → Village Organizations 683 traffic 916 sport 4228 environment 4873 communication 10162 De Fryske Marren → Sint Nicolaasga 146
vcjoure.nlVolleybal Vereniging VC JoureThe website of Volleybal Vereniging VC Joure presents the club, its activities, teams, events, and information for potential members and visitors.Team Sports → Volleyball 842 volleyball 617 sponsorship 2686 youth 3126 match 3471 training 28133 De Fryske Marren → Joure 689
vtbm.nlVereniging Ter Bevordering van de MotorsportThe website of Vereniging Ter Bevordering van de Motorsport provides information and organizes grass track races in the northern provinces of the Netherlands.Motorsport → Racing 228 standings 143 race 1043 sponsors 2642 volunteer 8367 membership 10442 Het Hogeland → Wehe-den Hoorn 23
csc-joure.nlCSC JoureThe CSC Joure website is an online platform for members and potential members of the sports club, providing information on the schedule, activities, member benefits, and the possibility to order sportswear. It also serves as a place for job postings and general meetings.Sports Clubs → Gymnastics 481 Early Years → Childcare 6029 tumbling 21 sportswear 352 gymnastics 502 volleyball 617 trial lesson 1433 member 10154 De Fryske Marren → Joure 689
itklimmerbled.nlIt KlimmerblêdThe website of It Klimmerblêd serves as an informative resource for parents, students, and other stakeholders of the Catholic primary school, providing information about the school, activities, contact details, and practical facilities.Primary Education → Catholic Primary Education 380 Childcare → Preschool 512 policy 2149 holiday 2295 childcare 3512 school 7856 education 13471 De Fryske Marren → Sint Nicolaasga 146
knooppuntjoure.nlKnooppuntjoure.nlThe website describes the Knooppunt Joure, a junction of the A6 and A7 highways in Friesland, and the history of the construction and development of this junction.Advertising → Online Advertising 948 Civil & Infrastructure → Roads 252 junction 11 highway 88 friesland 692 history 7286 Zaanstad → Zaandam 2740
nijemirdum.nlNijemirdum MunicipalityThe website of Nijemirdum provides information about the village, its history, events, accommodations, and recreational opportunities, and serves as a platform for local news and associations.Local Communities → Villages 1005 Village Focus → Village Life 262 recreation 799 accommodation 4921 history 7286 event 45199 De Fryske Marren → Nijemirdum 19
oranjevereniging-echtenerbrug.nlOranjevereniging EchtenerbrugThe Oranjevereniging Echtenerbrug website provides information about the events they organize in the villages of Echtenerbrug and Delfstrahuizen, particularly the annual Feestweek and other activities focused on community spirit and enjoyment.Local Events → Village Events 75 Village Focus → Village Organizations 683 feestweek 16 ticket sales 112 agenda 4374 membership 10442 event 45199 De Fryske Marren → Echten 54
pg-os.nlProtestantse Gemeente Ouwsterhaule-ScharsterbrugThe Protestant Community of Ouwsterhaule-Scharsterbrug is a community focused on meeting with God and with each other, with the goal of being a follower of Jesus Christ and supporting and encouraging each other.Protestantism → Protestant Church in The Netherlands (PKN) 301 Government & Administration → Local Municipalities 219 liturgy 238 church service 879 newsletter 6504 De Fryske Marren → Scharsterbrug 16
pknharich-oudega.nlPKN Oudega-Kolderwolde & Harich-RuigahuizenThe website of PKN Oudega-Kolderwolde & Harich-Ruigahuizen is an information source for the two independent Protestant congregations of Oudega-Kolderwolde and Harich-Ruigahuizen, which collaborate and share a pastor.Protestant Churches → Congregations 304 Reformed → Dutch Reformed Church 219 congregation 302 youth 3126 history 7286 De Fryske Marren → Ruigahuizen 13
toanielstnyk.nlStifting Toanielselsip St. NykThe website of Thússide – Toaniel Sint Nyk presents the history, activities, and contact information of the amateur theater group from Sint Nyk.Theater → Amateur Theater 120 Arts Education → Theater Education 112 theater 2544 foundation 6678 history 7286 performance 7586 member 10154 De Fryske Marren → Sint Nicolaasga 146
biljartclubhaskerhorne.nlBiljartclub HaskerhorneThe website of Biljartclub Haskerhorne presents information about the association, including news, competition results, and contact details.Team → Billiards 365 billiard 341 sponsors 2642 competition 4759 news 15293 De Fryske Marren → Haskerhorne 14
cmvcrescendoidskenhuizen.nlCMV Crescendo IdskenhuizenCMV Crescendo Idskenhuizen is an enthusiastic group of musicians playing in the 5th division and regularly performing concerts.Performance → Groups 123 Orchestras & Bands → Orchestras 1553 musician 1207 conductor 1217 concert 4409 membership 10442 De Fryske Marren → Idskenhuizen 12
degearte.nlM.F.C. de GearteThe website of MFC 'De Gearte' informs visitors about the multifunctional center in Bakhuizen and surrounding areas, and provides information about the facilities, events, and services offered by the center.Village Focus → Village Houses 214 Neighborhood Focus → Community Centers 941 foyer 33 youth center 44 sports hall 270 hall 1786 catering 6456 event 45199 De Fryske Marren → Bakhuizen 45
famberhorst.nlVrienden van HeremastateThis website provides information about the nature reserve ‘De Famberhorst’ in Skarsterlân, highlighting its history, location, and relationship to the nearby park Heremastate.Architecture & Sites → Historical Sites 1951 Nature → Nature Reserves 1032 nature reserve 339 's-Hertogenbosch → Empel 51
hsvstnyk.nlHengelsportvereniging Ons Genoegen St.NykHengelsportvereniging Ons Genoegen is a fishing association serving members in St. Nicolaasga and the surrounding area.Water → Lakes 232 Fishing → Fishing Clubs 190 fishing association 12 fish stock 15 permit 744 membership 10442 De Fryske Marren → Sint Nicolaasga 146
ijsbaanvanjoure.nlIJsclub De VleckeIJsbaan van Joure is an ice skating rink in Joure, Netherlands, open for skating and ice hockey, providing information about events and opening times.Skating → Ice Rinks 475 chocolate milk 17 rink 39 ice hockey 45 ice 178 skating 314 club 4225 De Fryske Marren → Sint Nicolaasga 146
indevrijloop.nlVereniging In de VrijloopVereniging In de Vrijloop provides activities and courses for people in the municipality of De Fryske Marren who do not or do not fully participate in the working process.Protestant Churches → Congregations 304 Cultural Experiences → Cultural Activities 279 charity shop 45 target group 578 association 8562
kleurrijkfryskemarren.nlKleurrijk Fryske MarrenThe website of the political party KFM - Kleurrijk Fryske Marren presents their vision, positions, and the list of council members.Local Politics → Political Parties 898 Local Politics → Municipal Council 484 council member 107 position 875 trust 1147 resident 3245 municipality 6837 De Fryske Marren → Lemmer 1188
kvdeoorsprong.nlKV de OorsprongKV de Oorsprong is the kaats (shuttlecock) club of St-Nicolaasga and Joure, and the website provides information about the association, its activities, and board changes.Municipalities → Governance 1043 Higher Education → Business Schools 11 meeting 2381 board 3438 member 10154 De Fryske Marren → Sint Nicolaasga 146
kvdtg.nlkv DTGThe website of korfbalvereniging De Tûke Goaier in Wijckel provides information about the association, its teams, events, sponsors, and memberships.Websites → Local Websites 45 Team Sports → Korfbal 406 korfbalvereniging 13 sponsors 2642 membership 10442 news 15293 De Fryske Marren → Wijckel 25
nsv-echtenerbrug.nlDutch Shuffleboard Association EchtenerbrugThe website of the Dutch Shuffleboard Association in Echtenerbrug aims to inform visitors about the association, the sport of shuffleboard, and the possibilities of booking shuffleboard for events.Conferences & Meetings → Corporate Events 2472 Team → Team Sports 2401 shuffleboard 16 association 8562 news 15293 event 45199 De Fryske Marren → Echtenerbrug 24
obstwaynien.nlYchtenerbrêgeThe Ychtenerbrêge primary school website provides information for interested parties about the school, its operations, and opportunities for students and parents.Primary Education → Catholic Primary Education 380 Primary & Secondary Schooling → School-Related 44 active learning 10 gift package 530 parent 4318 school 7856 education 13471 Southwest-Friesland → Sneek 1921
oudega-swf.nlOudega, Idzega & SandfirdenThe website Oudega, Idzega & Sandfirden serves as an information and news platform for the municipalities of Aldegea, Idzegea and Sânfurd in Friesland, focusing on local events, news, community initiatives, and nature information.Ornithology → Bird Conservation 170 Village Focus → Village Life 262 gas extraction 26 farm 2622 community 7931 nature 9094 news 15293 event 45199 Southwest-Friesland → Sandfirden 13
pbdetrijedoarpen.nlPlaatselijk Belang De Trije DoarpenPlaatselijk Belang De Trije Doarpen is an association that represents the common interests of the residents of the villages of Echten, Echtenerbrug, and Delfstrahuizen.Neighborhood Organizations → Residents’ Associations 965 Village Organizations → Local Interests 13 village 808 interest 911 meeting 2381 board 3438 municipality 6837 association 8562 De Fryske Marren → Echtenerbrug 24
ruterwille-jongutein.nlLR Ruterwille & PC Jong ut einLR Ruterwille & PC Jong ut ein is a club that organizes lessons, activities, and competitions for members of all ages.Livestock → Cattle 30 Team → Billiards 365 minutes 169 stables 212 facility 2616 club 4225 competition 4759 lesson 5154 De Fryske Marren → Joure 689
snvv.nlSNVVThe SNVV (Sint Nykster Volleybal Vereniging) website provides information about the volleyball association, its activities, news, events, and opportunities for membership and sponsorship.Sports Clubs → Gymnastics 481 Team Sports → Volleyball 842 volleyball 617 match 3471 association 8562 news 15293 event 45199 De Fryske Marren → Sint Nicolaasga 146
styleconsulting.nlStyle ConsultingThe website of Style Consulting offers color and figure analysis, personal styling advice, and wardrobe planning services, aiming to help clients discover their unique style and make a positive first impression.Personal Development → Self-Help 1791 Fashion → Style Advice 370 styling advice 96 color analysis 112 wardrobe 355 color 4159 De Fryske Marren → Joure 689
baxtegels.nlBax Tegels, PVC & VloerverwarmingBax Tegels, PVC & Vloerverwarming is a specialist in tiles and PVC floors, and underfloor heating systems in Friesland.Stone & Tiles → Tiles 895 pvc 522 natural stone 614 underfloor heating 757 tile 2869 showroom 4883 quote 12863 De Fryske Marren → Sint Nicolaasga 146
kokenvriend.nlKok and Vriend WoninginrichtingThe website of Kok and Vriend Woninginrichting in Venhuizen provides services for interior design and home furnishing, with a focus on curtains, flooring, and shading, and aims to help customers transform their homes into comfortable and stylish living spaces.Interior → Curtains 831 Decor & Furnishings → Home Goods Shops 27 home furnishing 113 shading 364 curtains 1015 atelier 1417 interior design 1802 floor 4781 Drechterland → Venhuizen 154
kringlooplemmer.nlEcologisch Kringloopcentrum De KuubsKistThe KuubsKist is a circular economy center and thrift store in Friesland and Flevoland, offering a diverse selection of secondhand items and an engaging experience.Commerce → Thrift Stores 160 thrift store 117 inventory 1613 furniture 8751 clothing 9443 De Fryske Marren → Lemmer 1188
jacolief.nlJacolienThe website Jacolief.nl provides information and inspiration about running and a healthy lifestyle, with a particular focus on recipes and training.Running → Running Shoes 21 running shoes 54 run 800 recipe 5142 blog 13392 event 45199 De Fryske Marren → Lemmer 1188
mooiblik.nlmooiblikThe website mooiblik.nl offers nostalgic advertising signs for various purposes, including home, garden, kitchen, and commercial spaces such as restaurants and cafes. The website also offers signs for special occasions like birthdays and father's day.Decoration → Wall Decoration 40 Local Events → Markets 1097 sign 126 decoration 4085 brand 17737 event 45199 De Fryske Marren → Oudemirdum 73
salon-mimosa.nlSalon MimosaSalon Mimosa is a professional beauty salon in Sint Nicolaasga, Friesland, offering a range of skin improvement treatments and a tanning studio.Cosmetics & Aesthetic → Personal Care 1001 Beauty → Tanning Beds 237 tanning studio 49 address 901 skin improvement 1058 salon 5541 brand 17737 treatment 21203 De Fryske Marren → Sint Nicolaasga 146
teatime.nlTea TimeThe website of Tea Time is an English tea room located in Echten, Drenthe, offering visitors an experience reminiscent of a British country house atmosphere.Tea & Coffee → Tea Rooms 229 Tourism → Cultural Attractions 698 high tea 585 tea 1146 villa 1351 newsletter 6504 menu 13856 De Fryske Marren → Echten 54
brekken.nlWatersportcentrum de BrekkenWatersportcentrum de Brekken is a watersports business located in Lemmer, offering boat rental, marina facilities, and watersport services.Water → Lakes 232 Accommodation → Cabins 231 marina 487 watersport 540 storage 2446 boat 2980 rental 7257 De Fryske Marren → Lemmer 1188
velehanden.nlVitec MemorixVeleHanden is a crowdsourcing platform dedicated to indexing and describing digital archives, with a focus on making historical documents and family history accessible to the public.Internet → Archives 422 Social Sciences → Genealogy & Family History 1403 family history 126 contribution 353 register 362 scan 790 archive 2067 Gelderland → Barneveld 2781
henx.nlHenk Veenstra FotografieThis website showcases the work of freelance photographer Henk Veenstra, featuring portraits and a variety of photographic projects.Nature & Landscape → Landscape Photography 530 Context 161394 industry 1780 city 1875 portrait 3685 photo 7778 event 45199 De Fryske Marren → Joure 689
bokkersband.nlBökkersThe website provides tour dates and locations for the Bie Wean = Metmaken Tour by Bökkers, a series of events and festivals.Popular → Pop 299 Music & Performance → Music Events 758 tour 2315 festival 3804 party 5928 music 13170 event 45199 Staphorst → Rouveen 128
marinastavoren.nlMarina StavorenRecreatiepark Marina Stavoren offers various accommodations and facilities on the IJsselmeer and the Friesian Lakes for recreation and watersports.Boating → Harbors 252 Boating → Marinas 825 winter storage 182 berth 341 watersport 540 swimming 850 camp 2466 Southwest-Friesland → Stavoren 155
terhernehaven.nlTerherne HavenThe Terherne Haven website provides information about the holiday park, accommodation options, the marina, and activities in the surrounding area.Boating → Marinas 825 Accommodation → Holiday Parks 1024 mooring 153 marina 487 holiday home 2753 arrangement 3104 De Fryske Marren → Goingarijp 86
camping-seleantsje.nlPiaccoCamping Molkwerum is a family-friendly campsite located on the IJsselmeer offering camping, chalets, and camper pitches with a variety of activities for all ages.Water → Boating 1592 Camping → Family Camping 50 chalet 1264 campsite 2093 restaurant 11215 Southwest-Friesland → Hindeloopen 127
boektotaal.nlBoektotaalThe website of Boektotaal offers bookbinding supplies, workshops, courses and repair services.Crafts → Bookbinding 79 Adult & Continuing Learning → Workshops 611 paper 770 leather 785 tool 3907 book 11396 course 14728 workshop 19325 De Fryske Marren → Echten 54
dekwikkel.nlDe KwikkelEetcafe De Kwikkel is a restaurant and café in Medemblik offering coffee, lunch, drinks, and dinner in a cozy environment.Fast Food → Fries 949 Context 161394 hamburger 364 meal 1638 coffee 3838 terrace 4847 drink 5191 De Fryske Marren → Lemmer 1188
venhop.nlCamping ’t VenhopCamping ’t Venhop is a family-run campsite offering a perfect holiday destination in West Friesland, near Hoorn and the Markermeer.Camping → Farm Camping 386 Accommodation → Cabins 231 camping site 35 cabin 351 cycle 1906 campsite 2093 De Fryske Marren → Lemmer 1188
picknickers.nlPicknickersRestaurant Picknickers is a foodbar and restaurant located on the Sneekermeer in Terherne, Friesland, offering organic food and drinks.Bars → Foodbars 22 Water → Lakes 232 foodbar 21 lake 352 terrace 4847 restaurant 11215 menu 13856 De Fryske Marren → Terherne 98
haskestaete.nlHaskestaete MakelaardijHaskestaete Makelaardij is a real estate agency located in Balk, Gaasterland, Friesland, specializing in the sale and purchase of properties in the region.Property Valuation & Appraisal → Regional Real Estate Agents 454 yield 292 result 1902 market 2772 house 8121 strategy 9379 De Fryske Marren → Balk 224
bakkervakkeuken.nlBakker VakkeukenBakker Vakkeuken is a specialist in kitchen technology and refrigeration technology for professional kitchens.Hospitality → Kitchen Equipment 315 Energy & Sustainability → Refrigeration 211 refrigeration technology 34 skilled workers 68 customization 1723 De Fryske Marren → Joure 689
verbiest.nlDansschool VerbiestDansschool Verbiest is a dance school and party center located in West Friesland that offers dance lessons and event hall rental for individuals and events.Dance → Dance Styles 429 opening dance 12 dance style 70 dance lessons 184 subscription 3287 event 45199 De Fryske Marren → Lemmer 1188
jachtwerfdejong.nlJachtwerf de Jong JoureThe website of Jachtwerf de Jong Joure showcases a range of wooden boats, including dinghies, sloops, and classic models, offering services focused on new construction, maintenance, restoration, and sales.Maritime → Shipbuilding 568 Water → Boats 935 dinghy 13 teak 103 sloop 272 restoration 3417 model 3546 paint 8747 De Fryske Marren → Joure 689
afekken.nlAannemersbedrijf A. Fekken B.V.Aannemersbedrijf A. Fekken B.V. is a construction and contracting company offering a wide range of services, from residential construction and stable construction to the restoration of old farmhouses and industrial halls.Construction Companies → Residential Construction 1013 Construction Companies → Regional Construction Companies 152 residential 216 farmhouse 878 restoration 3417 safety 5819 construction 7421 Southwest-Friesland → Heeg 227
moai-ald.nlMoai âldMoai âld is a brocante shop selling home accessories, gifts, and interior items.Antiques & Collectibles → Brocante 177 chalk paint 31 lantern 77 brocante 188 mold 356 fragrance 395 home accessories 603 De Fryske Marren → Lemmer 1188
in-zicht.nlStichting In-zichtStichting In-zicht is an organization focused on promoting awareness and supporting a world of harmony, unity, and abundance.Spirituality → Consciousness 193 awareness 1735 newsletter 6504 nature 9094 event 45199 De Fryske Marren → Joure 689
pluim-bestrating.nlStratenmakersbedrijf Pluim B.V.The website of Stratenmakersbedrijf Pluim B.V. in Oosterblokker presents the services of the company, primarily focused on landscaping, excavation, fencing, and other construction work for private individuals and businesses in the region.Garden → Paving 1003 Exterior Works → Excavation 316 carport 248 excavation 382 stone 724 veranda 1055 landscaping 1529 fence 1814 De Fryske Marren → Lemmer 1188
fryskeboekewike.nlBoeken van FryslânThe Fryske Boekewike is a week dedicated to promoting the Frisian book and taking place from November 8th to 16th, 2025, featuring the Kadoboek.Language Learning → Language Education 427 Culture → Literature 3578 bookstore 149 book 11396 event 45199 De Fryske Marren → Balk 224
locallio.nlLocallio B.V.Locallio is a website and app that helps users find local businesses and services in their area.Local & Regional Focus → Local Businesses 1077 flyer 274 promotion 2062 shop 6483 restaurant 11215 Vijfheerenlanden → Ameide 97
schaakclublemmer.nlSchaakclub LemmerThe website of Schaakclub Lemmer provides information about the club, events, competition, and collaboration with the Library of Lemmer for chess lessons.Chess → Chess Clubs 261 chess lesson 16 chess club 123 season 692 library 988 competition 4759 De Fryske Marren → Lemmer 1188
mobieleklimwand.nlMobile Climbing WallThe website presents a mobile climbing wall that can be rented for various events and occasions, such as street parties, sporting events, and festivals.Children’s Activities → Playgrounds 702 Sport Facility → Climbing 202 climbing wall 12 climbing 139 instructor 3126 event 45199 Deventer → Schalkhaar 138
nixin.nlnixin.nlThe website nixin.nl features a blog with personal stories and experiences, primarily focusing on travel, birdwatching (especially the mees/blackbird), handmade crafts (beer making), and descriptions of daily moments and activities.Internet → Forums & Communities 1599 Hobbies → Bird Collection 14 bird 922 ride 1075 memory 1641 beer 2887 travel 7210 blog 13392 De Fryske Marren → Lemmer 1188
desapsommelier.nlDe SapsommelierThe website showcases specialty juices made from Dutch fruits, emphasizing a natural flavor experience.Beverages → Tea 829 Beverages → Juice 26 blend 145 juice 207 sun 209 flavor 1032 fruit 1166 tree 1879 De Fryske Marren → Lemmer 1188
dutchdartsmedium.nldutchdartsmedium.nlThe website presents news articles on a variety of topics, including sports (football), economics, technology, and current events.Environmentalism → Social Issues 29 Culture & Arts → Opinion 296 pandemic 94 football 1347 talent 3987 technology 6816 news 15293 De Fryske Marren → Sint Nicolaasga 146
vrswestfriesland.nlVRS West-FrieslandThe website of Vogelringstation West-Friesland (VRS West-Friesland) provides information about the activities of the bird banding station, which focuses on bird (ring) research in the West-Friesland region of North Holland.Government & Administration → Government Organizations 1002 Nature → Ornithology 505 west-friesland 41 north holland 138 data 5872 De Fryske Marren → Lemmer 1188
administratiekantoor-devries.nlAdministratiekantoor A & W de VriesThe website of Administratiekantoor A & W de Vries in Lemmer offers financial and administrative services to private and business clients in the province of Friesland, Netherlands. The office emphasizes a personal and efficient service, with short lines to specialists and a focus on avoiding unnecessary costs and complex processes.Commercial Properties → Offices 773 Human Resources → Payroll 515 accounting firm 250 payroll 1823 office 2898 De Fryske Marren → Lemmer 1188
startlijsten.nlStartlijstenStartlijsten.nl is a platform providing match lists for competitive equestrian sports.Football → Competitions 1072 Nature → Zoology 180 jump 92 dressage 195 breed 1744 horse 4337 competition 4759 training 28133 Lochem → Barchem 122
legerstee-watersport.nlLesteree-watersport.nlThe website, Lesteer-watersport.nl, is an information platform about watersports, with a focus on surfing and related offers and products.Websites → Information Sites 174 Water Sports → Surfing 143 surf 107 watersport 540 boat 2980 Olst-Wijhe → Wijhe 284
plantingjoure.nlPlanting Stalen MeubelenPlanting Stalen Meubelen is a manufacturer of steel frames for furniture.Tables → Dining Tables 154 sofa 481 frame 883 chair 1223 table 1778 transport 6105 De Fryske Marren → Joure 689
bakkerijmeinsma.nlBakkerij Meinsma 'De Korenaar'Bakkerij Meinsma 'De Korenaar' is a bakery located in Balk, Friesland, that sells and delivers bread and pastries in the region.Bakery & Food Production → Bread 765 Ice Cream → Ice Cream Parlors 521 pastry 206 friesland 692 bakery 718 bread 1622 store 3901 De Fryske Marren → Balk 224
eddiemulder.nlEddie MulderThis website is the personal website of Eddie Mulder, a guitarist with a long and diverse musical career, focusing on his solo performances and discography.Musicians → Guitarists 20 Popular → Rock 942 guitar 1091 session 1791 band 2977 performance 7586 music 13170 De Fryske Marren →  Rotsterhaule 19
hamstraijzerenmetalen.nlJan Hamstra ijzer en metalenThe website of Jan Hamstra ijzer en metalen presents the services of the company, primarily the collection and recycling of metals, demolition work, and the disassembly of machines, as well as the provision of containers.Waste Management → Recycling 1027 Building & Materials → Demolition 687 scale 194 recycling 1036 metal 1090 demolition 1144 container 1709 De Fryske Marren → Balk 224
tjeerdengel.nlTjeerd EngelThe website of Tjeerd Engel offers web design, web development, and SEO services, focused on businesses in Friesland and the surrounding area. The goal is to help clients improve their online visibility and create professional websites.Online Marketing → SEO 1123 friesland 692 web development 965 online marketing 1085 wordpress 3551 seo 3707 webdesign 4092 De Fryske Marren → Lemmer 1188
berendbotje.nlKinderopvang Berend BotjeKinderopvang Berend Botje provides professional and personal childcare in North Holland and West Friesland.Childcare → Nanny Care 301 nanny 224 pedagogy 402 childcare 3512 parent 4318 De Fryske Marren → Lemmer 1188
ballonfeesten.nlStichting Friese BallonfeestenThe website for the Friesian Balloon Festival in Joure provides information about the annual balloon event, including the current program, the option to book balloon flights, and ways to support the festival.Festivals → Music Festivals 1020 Adventure → Hot Air Ballooning 93 balloon 554 festival 3804 donation 5110 De Fryske Marren → Joure 689
gsmmasten.nlgsmmasten.nlThis website provides an overview of the locations of mobile base stations (GSM, UMTS, 4G, 5G, and C2000) in the Netherlands, allowing users to enter their city or postcode to find the nearby stations.Communication → Mobile Communication 27 Context 161394 4g 11 gsm 29 5g 46 mast 80 De Ronde Venen → Abcoude 472
wit-west-friesland.nlFamily Wit West-FrieslandThis website is a digital family tree and genealogical overview of the Wit family and other related lineages from West-Friesland and the Kop of North Holland, focused on preserving and making accessible family trees, photos, documents, and stories.Websites → Personal Websites 541 Social Sciences → Genealogy & Family History 1403 search function 273 family tree 448 document 1678 family 6462 photo 7778 story 8285 De Fryske Marren → Lemmer 1188
makelaardijhoekstra.nlMakelaardij HoekstraMakelaardij Hoekstra is a real estate brokerage based in various locations in Friesland that offers services for both the sale and purchase of homes and commercial properties, as well as real estate management and appraisals.Automotive → Sales 1205 real estate brokerage 55 real estate management 123 commercial property 469 appraisal 1488 new construction 2672 home 7976 Southwest-Friesland → Sneek 1921
buurtbuszwf.nlStichting Buurtbus Hemelum – StavorenThe website of Buurtbus ZuidWest Friesland provides information about the local bus service between Hemelum and Stavoren, including schedules, fares, news, and contact information.Public Transportation → Regional Transportation 92 Water Transportation → Ferries 129 ferry 179 schedule 2624 volunteer 8367 Southwest-Friesland → Stavoren 155
zadenbibliotheeknederland.nlZadenbibliotheek NederlandThe website Zadenbibliotheek Nederland provides information and access to a network of volunteer seed libraries across the Netherlands, where visitors can borrow, exchange, and donate seeds.Social Issues → Social Organization 13315 Gardening → Seeds 319 gardening 505 seed 599 library 988 collection 7566 volunteer 8367 De Fryske Marren → Joure 689
electriceel.nlElectric EelThe Electric Eel website is an information page and online shop of a family business that deals with the sale of fresh-caught and smoked fish, particularly eel and other types, and provides information about fishing activities in the region.Fish & Seafood → Fish 388 Water Activity → Fishing 1055 fisherman 26 eel 47 smoking 115 family business 793 fish 1121 Southwest-Friesland → Heeg 227
woonlab.nlWoonlabWoonlab is an advisory firm specializing in providing advice and guidance to housing corporations, governments, and social organizations in the broad field of housing.Government & Administration → Oversight 82 self-evaluation 12 merger 323 housing 4378 De Fryske Marren → Balk 224
tolhuisjoure.nlHet Tolhuis JoureThe Tolhuis Joure is a restaurant, bar, and Grand Café in Joure offering various services including meals, drinks, catering, and accommodation.Cafes → Grand Cafés 228 Cafes → Brown Cafés 599 grand café 95 bar 1216 catering 6456 restaurant 11215 menu 13856 event 45199 De Fryske Marren → Joure 689
ziekenhuischeck.nlZiekenhuischeckThe website provides information about the quality of Dutch hospitals and treatments.Patient Services & Rights → Patient Information 158 Hospital & Acute Services → Hospitals 735 scores 48 hospital 560 compare 582 care 12338 treatment 21203 Land van Cuijk → Boxmeer 861
meelmolendeherder.nlDe Herder MillThis website provides information about the ‘De Herder’ mill in Medemblik, including its history, operation, tour arrangements, and surrounding area.Urban History → Local History 1654 Tourism → Cultural Attractions 698 grain 192 windmill 249 mill 487 tour 2315 arrangement 3104 history 7286 De Fryske Marren → Lemmer 1188
stadsarrangement.nlStadsarrangementThe website Stadsarrangement offers a wide range of fully organized corporate outings and staff outings in the Netherlands, Belgium, and Germany.Corporate Events → Team Building 1005 staff outing 17 corporate outing 388 team building 720 outing 982 city 1875 The Hague → Scheveningen 1625
brasseriedebrink.nlBrasserie de BrinkBrasserie de Brink is a brasserie located in Oudemirdum, Friesland, offering traditional cuisine with meat, fish, and vegetarian dishes, and providing access to walking and cycling routes near the IJsselmeer.Brasseries & Bistros → Brasserie 1005 Cycling → Cycling Routes 1002 walking area 40 brasserie 752 reservation 3373 menu 13856 De Fryske Marren → Oudemirdum 73
skutsjeverhuurhaghe.nlSkutsjeverhuur HagheThe website of Skutsjeverhuur Haghe offers and promotes the opportunity to rent a traditional Friesian skûtsje ("Aleida Hendrika") for sightseeing trips and day trips between Heeg and Balk.Water Travel → Boat Tours 640 National Identity → Frisian Culture 11 skûtsje 57 water 2501 arrangement 3104 nature 9094 De Fryske Marren → Balk 224
brasserie-no14.nlBrasserie No. 14The website of Brasserie No. 14 presents a restaurant in Lemmer offering culinary experiences with fresh ingredients and a cozy atmosphere, and potentially offering arrangements and events.Bars & Pubs → Casual Dining 217 Water Sports → Water 2963 brasserie 752 guest 1334 terrace 4847 menu 13856 De Fryske Marren → Lemmer 1188
centrumlemmer.nlRestaurant CentrumRestaurant Centrum is a restaurant located in Lemmer that offers a variety of meals and catering services, including lunch, dinner, fingerfood, buffets, and catering for special occasions.Cafes → Dutch Restaurants 1031 Catering & Ready Meals → Asian Restaurant 163 buffet 1747 reservation 3373 catering 6456 restaurant 11215 menu 13856 De Fryske Marren → Lemmer 1188
leeneenfries.nlFERS and the Friese BibliothekenThe website ‘Leen een Fries’ showcases stories from Fries residents to share the culture and history of Friesland.Travel & Exploration → Maritime History 103 Personal → Personal Stories 1027 friesland 692 fries 2753 portrait 3685 culture 3922 story 8285 event 45199 De Fryske Marren → Sint Nicolaasga 146
zeilcharter.nlZeilcharter.nlZeilcharter.nl is a website offering boat and yacht rentals, primarily ships from the ‘brown fleet’. The site provides opportunities for various types of sailing trips and rentals, targeting private customers, businesses, schools, and associations.Sailing → Sailing Trips 124 sailing ship 29 person 448 trip 2032 ship 5103 De Fryske Marren → Lemmer 1188
dejongensvanjoure.nlDe Jongens van JoureThe Jongens van Joure is a restaurant and grand café located in Joure that serves traditional and modern dishes and organizes events.Places → Towns 380 Team → Billiards 365 fish 1121 space 3846 wine 4476 restaurant 11215 menu 13856 event 45199 De Fryske Marren → Joure 689
dejoustertoer.nlThe JoustertoerThe Joustertoer website provides information about the restaurant and a new culinary location in Joure.Architecture & Sites → Historical Sites 1951 Bars & Pubs → Gastropubs 57 culinary 199 gift voucher 548 hospitality 3491 restaurant 11215 event 45199 De Fryske Marren → Joure 689
2wielercentrumjoure.nl2Wielercentrum JoureThe website of 2Wielercentrum Joure is a bicycle shop in Joure that sells new and used bicycles, repairs bicycles, and offers bicycle rentals.Repair → Bicycle Repair 405 Cycling → Bicycle Sales 455 bicycle shop 99 cargo bike 278 bicycle 2838 coffee 3838 rental 7257 repair 14576 De Fryske Marren → Joure 689
vankoptotstaart.nlDierenkliniek Van Kop tot StaartDierenkliniek Van Kop tot Staart is a veterinary clinic located in West-Friesland specializing in companion animals and offering various services and information.Veterinarians → Veterinary Clinics 419 Animals → Pets 1382 companion animals 83 owner 515 veterinarian 864 practice 9089 appointment 13510 De Fryske Marren → Lemmer 1188
hotellemmer.nlHotel LemmerHotel Lemmer is a hotel located in Lemmer, Netherlands, offering a range of accommodations and facilities, including rooms, breakfast, a bar/lounge, and bicycle rental options, as well as event organization.Hotels → Country Hotels 122 Accommodation → Guesthouses 726 bar 1216 parking 1928 bicycle 2838 room 3411 hotel 3543 garden 13129 De Fryske Marren → Lemmer 1188
maelsonapotheek.nlMaelson ApotheekThe Maelson Apotheek in Hoorn provides a range of services, including prescription refills, online medication ordering, and medical information access through a medical encyclopedia. The pharmacy also operates as a 24-hour service pharmacy with adjusted rates on weekends and outside of office hours.Pharmaceuticals & Medical Products → Pharmacies 1029 service pharmacy 15 pharmacy 702 prescription 859 medication 1164 patient 4082 registration 4366 De Fryske Marren → Lemmer 1188
marcoseetcafe.nlMarco's EetcaféMarco's Eetcafé is a cafe and eatery in Joure offering catering, takeaway menus, and a terrace.Venues → Event Spaces 432 Quick Bites → Snack Bar 580 snack bar 162 cafe 1622 coffee 3838 terrace 4847 catering 6456 De Fryske Marren → Joure 689
samsgrillroom-lemmer.nlSam's Grillroom LemmerSam's Grillroom Lemmer is an online restaurant where visitors can order food from the menu and have it delivered.Fast Food → Burger Restaurants 346 Pastries & Baked Goods → Menus 223 chicken fillet 35 shawarma 335 plate 787 sauce 1141 sandwich 4098 pizza 4158 De Fryske Marren → Lemmer 1188
tessaspijker.nlTessa SpijkerThis website presents the portfolio of Tessa Spijker, a freelance graphic designer and illustrator.Design & Creative → Graphic Services 1003 Architecture & Design → Creative Industries 1157 label 819 poster 837 illustration 2447 branding 4614 logo 4660 De Fryske Marren → Harich 35
demastmakersdochters.nlJack van OmmenThe website presents a story, based on the memoirs of the author’s mother, about the lives of two female cousins named Rennie de Vries and Rennie van Ommen-de Vries in the early 20th century. The story covers the impact of the Zuiderzee Works, World War II, and the experiences of Dutch women in the outside command of Dachau.Specialized History → World War II 1134 Personal → Biography 1003 memoir 14 shipyard 130 resistance 230 De Fryske Marren → Lemmer 1188
meditec.nlMeditecMeditec is a company specializing in single-use medical materials and supplies for clinics.Pharmaceuticals & Medical Products → Medical Supplies 388 Medical Care & Services → Medical Equipment & Aids 518 endoscopy 13 csa 27 clinic 1079 account 5781 order 6912 De Fryske Marren → Lemmer 1188
teakefraterman.nlTeake FratermanThis website by Teake Fraterman presents information about pigeon racing, specifically his own pigeon lines and achievements, as well as a transition to gardening.Dogs → Breeding 667 Outdoor Activity → Pigeon Racing 203 achievement 58 line 236 pigeon 284 results 3954 plant 4509 garden 13129 De Fryske Marren → Sint Nicolaasga 146
runningbunnys.nlRunning Bunny’sRunning Bunny’s is a business offering trimming, care, and advice services for rabbits and guinea pigs.Animals → Animal Care 1849 Personal & Household → Household Services 1050 petting zoo 110 trim 221 rabbit 291 nutrition 4935 care 12338 Drechterland → Venhuizen 154
salomobikes.nlSalomo BikesSalomo Bikes is a specialist bicycle shop in Medemblik that sells race bikes, mountain bikes, and e-bikes, along with related parts and accessories.Cycling → Road Bikes 55 Cycling → Mountain Bikes 51 e-bike 908 bike 1541 part 5044 accessories 12975 brand 17737 De Fryske Marren → Lemmer 1188
berekenuwrechtplus.nlberekenuwrechtplus.nlThe BerekenUwRecht program helps users determine if they are entitled to a municipal allowance.Assistance Services → Financial Assistance 224 Legal → Legal Aid 420 living situation 18 allowance 163 asset 591 income 660 municipality 6837 Maastricht → Maastricht-Southeast 113
stokertje.nl't StokertjeThe website 't Stokertje offers a wide range of fireplaces and stoves, including advice, installation, and maintenance.Heating → Stoves 301 Heating → Fireplaces 578 stove 305 fireplace 752 assortment 7799 installation 13742 brand 17737 maintenance 20093 Midden-Drenthe → Orvelte 54
cadvb.nlCADVBThe website of CADVB offers services in the field of BIM (Building Information Modeling) and technical building consulting, with a focus on supporting companies with the implementation of BIM processes.Architecture → BIM 53 Architecture & Design → Building Consulting 314 architectural drawings 27 3d modeling 67 bim 307 consulting 3639 Noordoostpolder → Emmeloord 1649
stinzenflora-monitor.nlStinzenflora MonitorThe Stinzenflora Monitor website provides information about the blooming times of stinzenplants (rare plant species) in the Netherlands, including a blooming calendar, a map, and tips for spotting these unique plants at historical locations.Stories → Travel Blogs 1016 Nature → Botany 190 tips 2789 De Fryske Marren → Wijckel 25
laptopleasing.nlLaptopleasing.nlLaptopLeasing provides MKB (SME) businesses with lease packages for complete laptop and desktop workstations, including installation and service, aiming to offer flexible and professional IT solutions.Technology → IT 3337 Electronics & Components → Computer 4084 hardware 941 laptop 1320 installation 13742 De Fryske Marren → Joure 689
spitfire.nlTriumph Spitfire ClubThe website of the Triumph Spitfire Club aims to preserve and keep the Triumph Spitfire and GT6 vehicles running.Cars → Classic Cars 1145 Maintenance & Services → Automotive Clubs 153 rally 286 forum 1362 membership 10442 Apeldoorn → Loenen 220
carolavriend.nlCarola VriendThe website of Carola Vriend offers personalized funeral care services in West-Friesland and Waterland, focusing on guidance and arranging all aspects of the funeral, from capturing wishes to organizing the burial or cremation.Social Services → Grief Support 587 Family → Funeral Services 2084 burial 406 cremation 615 cost 1990 funeral 2477 wishes 2717 De Fryske Marren → Lemmer 1188
nieuwbouw-waterlant.nlBPD | Bouwfonds GebiedsontwikkelingThe Waterlant website presents a new construction project in Zuid-Scharwoude, targeting potential buyers seeking to live in a water-rich and green environment with convenient amenities.Nature → Nature Reserves 1032 Nature Conservation → Landscape Conservation 114 home type 18 water 2501 schedule 2624 home 7976 sustainability 18451 De Fryske Marren → Lemmer 1188
ericmijnster.nlEric MijnsterThe website of Eric Mijnster presents his creative work, including performances, books, and a documentary, and offers opportunities to view or book performances.Freelancers → Writers 609 Film → Documentaries 813 flow 263 journey 701 documentary 1081 performance 7586 book 11396 De Fryske Marren → Balk 224
twitterdebatkennisinnovatie.nlOnbekendThis website provides information about the city of Heerhugowaard in North Holland, including attractions and local news sources.Cycling → Cycling Routes 1002 cycling path 27 west-friesland 41 north holland 138 city center 201 Bergen → Schoorl 481
financieringsgilde.nlFinancieringsgildeThe website of Financieringsgilde provides advice and financing solutions for businesses. Its goal is to help entrepreneurs with arranging business financing, such as mortgages, loans, and crowdfunding.Finance → Loans & Credit 1979 crowdfunding 246 scan 790 loan 832 mortgage 4564 real estate 4981 finance 5341 Overbetuwe → Andelst 133
mobilito.nlMobilitoMobilito is a sports center and physiotherapy practice in Hoorn (Oosterblokker) offering training and therapy services.Group Class → Fitness Centers 1010 Personal & Household → Fitness Services 162 gym 699 group classes 1306 fitness 2251 lifestyle 2918 physiotherapy 4688 training 28133 De Fryske Marren → Lemmer 1188
kleinebeerbrouwerij.nlKleine Beer BreweryThe website of Kleine Beer Brewery presents their range of beers and food, provides information about the brewery and the events they organize.Beer → Breweries 337 beer 2887 food 3872 event 45199 De Fryske Marren → Lemmer 1188
lab32architecten.nlLab32 architectenLab32 architecten is an architectural firm located in South Limburg that designs modern villas and homes for private and business clients.Project Management → Construction Supervision 364 architect 609 villa 1351 partner 4272 design 27202 Sittard-Geleen → Einighausen 26
vaarhuis.nlVaarHuis Groep B.V.The website Huisboothuren.nl offers the opportunity to rent houseboats in Friesland, with locations on the Frisian lakes and information on arrangements, routes, and local attractions.Hotels → Alternative Accommodation 27 Travel Guides → Regional Travel Guides 85 houseboat 130 friesland 692 arrangement 3104 Heerenveen → Akkrum 246
biovalue.nlBioValueThe website of BioValue presents their expertise in the management and construction of biogas facilities, and describes their role in converting organic waste products into green gas, bio-CNG, and bio-LNG, aiming to promote a more sustainable energy supply.Energy → Energy Generation 144 Environment → Environmental Technology 712 green gas 25 biomass 107 energy 9075 sustainability 18451 De Fryske Marren → Sint Nicolaasga 146
wonenindefryskemarren.nlMunicipality of De Fryske MarrenThe website of De Fryske Marren – Kavel presents various building plots for sale in the De Fryske Marren project area, providing information on available plots, prices, and project-based options.Land → Building Plots 49 Context 161394 building plot 80 block 91 municipality 6837 price 8328 De Fryske Marren → Balk 224
hoffanlemmer.nlHof fan LemmerThe Hof fan Lemmer website offers building plots and project homes in Lemmer, Friesland, and allows potential buyers to register and design their own home.New Construction → Neighborhood Development 933 Land → Building Plots 49 building plot 80 living 578 plot 1051 water 2501 home 7976 design 27202 De Fryske Marren → Lemmer 1188
boerderijrecreatie.nlBoerderijrecreatieBoerderijrecreatie offers various activities and arrangements for groups and individuals in Friesland, with a special focus on a unique and cozy farm location.Food & Dining → Hiking Routes 39 cow 596 farm 2622 family 6462 event 45199 De Fryske Marren → Delfstrahuizen 47
lamereanne.nlLa Mère AnneLa Mère Anne is a restaurant, party venue, and suitehotel located on the border between West Friesland and Waterland, with a long history.Regional Cuisine → Regional Restaurants 57 Venues → Wedding Venues 232 wine 4476 restaurant 11215 menu 13856 De Fryske Marren → Lemmer 1188
slotenmakerdrs.nlDRS Lock SpecialistThe website is an online advertisement for DRS Lock Specialist, a locksmith service provider operating in various regions of the Netherlands.Repair → Lock Repair 266 Security & Surveillance → Security 3251 locksmith 919 locks 953 reviews 3172 security 6655 repair 14576 Leeuwarden → Bears 16
indysign.nlIndysignThe website of Indysign describes a communication agency offering services ranging from strategy and concept development to advertising, technological support, and website building.Radio & Communication → Networks 341 Civil & Infrastructure → Infrastructure Projects 131 cartography 41 film 3007 concept 3338 technology 6816 strategy 9379 North-Holland → Amsterdam 41253
terhernenautic.nlJachtbemiddeling Terherne-NauticThe website of Jachtbemiddeling Terherne-Nautic provides services related to the purchase, sale, and maintenance of boats, particularly motor yachts and other recreational boating vessels. The website serves as a one-stop-shop for boat enthusiasts.Boats → Motor Yachts 34 Transportation → Commercial Services 134 mooring 153 brokerage 433 yacht 647 boat 2980 maintenance 20093 De Fryske Marren → Terherne 98
innerpeacecounseling.nlInner Peace CounselingInner Peace Counseling provides counseling services to expats and English speakers in the Netherlands, focusing on supporting individuals through transitions and challenges.Mental & Emotional Well-Being → Anxiety 1169 expat 344 depression 408 counseling 741 netherlands 1376 challenge 1697 session 1791 De Fryske Marren → Lemmer 1188
snowsportsjoure.nlSnowsports JoureSnowsports Joure is a ski school that offers winter sports enthusiasts, from beginners to experienced skiers, a safe and enjoyable way to learn and practice, both indoors and in preparation for the real snow.Winter Sports → Snowboarding 179 ski 256 snowboard 352 instructor 3126 lesson 5154 shop 6483 De Fryske Marren → Joure 689
woodssteps.nlWoodsstepsWoodssteps is a website offering outdoor activities, specifically packrafting, in the Rijs and Gaasterland region, focused on adventure, relaxation, and group outings.Outdoor & Recreation → Group Activities 509 Sports → Water Activity 5912 group activity 84 day trip 257 adventure 919 nature 9094 De Fryske Marren → Rijs 32
hotelboschlust.nlHotel-Restaurant BoschlustThe website aims to promote Hotel-Restaurant Boschlust, a hotel and restaurant in Gaasterland, Friesland, offering comfortable accommodation and local cuisine.Accommodation → Holiday Parks 1024 Tourism → Regional Tourism 242 hotel 3543 accommodation 4921 restaurant 11215 menu 13856 De Fryske Marren → Oudemirdum 73
postmarkten.nlPost MarktorganisatieThe website of Post Markten presents and organizes (fleamarkets) markets and fairs in various municipalities in the province of Drenthe, with the aim of reaching a wide audience and providing market traders with a good location.Markets → Flea Markets 169 Local Events → Fairs 707 fairs 83 market 2772 event 45199 Achtkarspelen → Surhuisterveen 281
loketgevondenvoorwerpen.nlN/AThe website Lost and Found Items is a platform where users can report lost items and register found items. It provides a central place to recover lost belongings in various municipalities.Online Services → Platforms 537 Governance → Law 14133 lost 13 finds 68 tag 70 search 1027 item 1125 municipality 6837 De Fryske Marren → Lemmer 1188
solexsloten.nlSolexverhuur SlotenThe website of Solexverhuur Sloten offers rentals of solexes and e-choppers, with various tours and arrangements through Friesland, with a focus on group outings and a feeling of joy.Cycling → Bicycle Rental 643 Activities → Group Outings 133 solex 61 group activity 84 e-chopper 122 tour 2315 arrangement 3104 route 3425 Amsterdam → Sloten 146
gymplaza.nlGymplazaGymplaza Sint Nicolaasga offers a range of fitness services including free fitness, group classes, personal training, and physiotherapy, aimed at helping members achieve their goals.Fitness Centers → Individual Fitness 25 personalized guidance 20 group classes 1306 fitness 2251 physiotherapy 4688 training 28133 De Fryske Marren → Sint Nicolaasga 146
jachthavenslump.nlJachthaven Slump LemmerThe Jachthaven Slump Lemmer website provides information and booking options for fixed berths on the IJsselmeer, emphasizing its favorable location and amenities.Boating → Marinas 825 Camping → Camper Sites 243 winter storage 182 berth 341 amenities 363 De Fryske Marren → Lemmer 1188
dierenasiel-hoorn.nlDierenasiel HoornDierenasiel Hoorn is a animal shelter providing temporary shelter for stray and abandoned animals, with the goal of finding them a new, loving home.Dogs → Pet Care 387 Animal Welfare → Animal Shelters 326 adoption 359 shelter 385 cat 1578 animal 2908 dog 5483 volunteer 8367 De Fryske Marren → Lemmer 1188
projectmatch2work.nlMatch 2 WorkThe website Match 2 Work connects companies with educational institutions to bridge the gap between theoretical knowledge and practical experience for students and learners.Education & Training → Educational Software 274 Education → Pedagogy & Methods 2944 case study 56 employer 2383 teacher 2890 student 7623 education 13471 Noordwijk → Noordwijkerhout 1099
daredevilsband.nlDaredevilsThis website presents the band Daredevils, a party band that performs at festivals and other events, and offers information about their upcoming concerts and a mailing list.Rock → Progressive Rock 52 mailing list 71 band 2977 concert 4409 event 45199 Leeuwarden → Inner City and Station District 44
bistrofredjoure.nlBistro Fred and JoureThe website of Bistro Fred and Joure is an online presentation of a bistro in Joure, offering a wide range of dishes and drinks in a cozy ambiance and providing options for takeaway, reservations, and location information.Water → Boating 1592 Brasseries & Bistros → Bistro 594 bistro 219 reservation 3373 terrace 4847 dish 5936 menu 13856 De Fryske Marren → Joure 689
ambion.nlAmbionThe website of Ambion describes a group of 22 public primary schools in the Joure and Heerenveen region, offering quality education with a focus on trust, connection, and development, particularly emphasizing innovation and the implementation of the Apple learning environment.Primary Education → Public Education 424 course plan 10 innovation 4659 school 7856 education 13471 De Fryske Marren → Joure 689
echopperz.nlEchopperz.nlThe website Echopperz.nl offers the rental of electric E-Choppers in Friesland, Drenthe and Groningen, with the focus on providing an outdoor experience for individuals, families and businesses.Cycling → Electric Bikes 445 Taxi & Ride Services → Personal Transport 28 e-chopper 122 nature area 497 tour 2315 landscape 2609 route 3425 Noordenveld → Norg 322
luchtverwarmingshop.nlEconvice NederlandLuchtverwamingshop.nl is a webshop that sells and arranges the replacement of air heaters.Installation & Repair → Ventilation 859 part 5044 webshop 8648 De Fryske Marren → Joure 689
makelaar-west-friesland.nlMakelaar West-FrieslandMakelaar West-Friesland offers home selling services in West-Friesland with a fixed fee.International Property Markets → International Real Estate Transactions 15 fee 640 sale 5930 marketing 7107 house 8121 De Fryske Marren → Lemmer 1188
stinsemaat.nlStinseMaat MakelaardijStinseMaat Makelaardij is a NVM real estate agency located in Heerenveen that offers properties for sale and rent.Commercial Property → Commercial Space 489 Real Estate → Property Search & Listings 506 agent 1253 purchase 2212 valuation 2697 property 7406 house 8121 Heerenveen → Oranjewoud 64
leroytuin.nlEcokathedraal Le Roy-tuin FoundationThe website of the Ecokathedral Le Roy-garden in Heerenveen provides information about this unique ecological project, where humans, plants, and animals work together in a green space. It also presents news articles, event schedules, and historical documentation about the garden.Nature → Environmental Management 529 Parks & Gardens → Garden 501 history 7286 garden 13129 news 15293 event 45199 Vijfheerenlanden → Leerdam 672
lvwcn.nlLuchtgekoelde VW Club NederlandThe Luchtgekoelde VW Club Nederland is a club dedicated to preserving original air-cooled Volkswagens.Cars → Classic Cars 1145 volkswagen 221 taxation 344 magazine 2182 member 10154 event 45199 De Fryske Marren → Echten 54
kokogo-ballonvaart.nlKoKoGo Balloon RidesThe website of KoKoGo Balloon Rides offers opportunities to book hot air balloon trips throughout the Netherlands, with a focus on a complete adventure and a guarantee against bad weather.Adventure → Hot Air Ballooning 93 hot air balloon ride 14 hot air balloon 36 pilot 208 gift certificate 646 Maasgouw → Thorn 120
pannenkoekenboerderijderoos.nlPannenkoekenboerderij de RoosPannenkoekenboerderij de Roos is a pancake farm and restaurant in Terherne, Friesland, serving pancakes, coffee, and pastries.Family & Themed Dining → Pancake Restaurants 166 Tourist Destinations → Countryside 14 pancakes 568 farm 2622 coffee 3838 vacancy 6598 restaurant 11215 De Fryske Marren → Terherne 98
kinderdagverblijfboris.nlKinderdagverblijf BorisKinderdagverblijf Boris is a childcare and after-school care facility located in Wognum, West-Friesland, providing a safe and development-oriented childcare environment.Childcare → Daycare Centers 987 Children’s Activities → Playgrounds 702 bso 335 childcare 3512 parent 4318 child 11566 De Fryske Marren → Lemmer 1188
snnhn.nlSchoudernetwerk Noord Holland NoordThe website Schoudernetwerk Noord Holland Noord provides an overview of affiliated physiotherapy practices in the region of Noord Holland Noord and informs patients about shoulder specialists and relevant information regarding shoulder problems.Podology → Orthopedics 1525 Radio & Communication → Networks 341 physiotherapist 453 network 11123 care 12338 collaboration 16036 De Fryske Marren → Lemmer 1188
paviljoensalt.nlPaviljoen SaltPaviljoen Salt is a restaurant and cafe located in Terherne, open year-round, where visitors can enjoy lunch, drinks, and/or dinner, with a focus on fresh, seasonal ingredients and a relaxed atmosphere.Brasseries & Bistros → French Cuisine 146 coziness 235 water 2501 terrace 4847 restaurant 11215 menu 13856 event 45199 De Fryske Marren → Terherne 98
hetnederlandsbachconsort.nlThe Nederlands Bach ConsortThe Nederlands Bach Consort is a vocal ensemble that combines Bach's music with contemporary music in experimental concert programs.Baroque Music → Bach 26 bach 43 ensemble 546 concert 4409 story 8285 music 13170 Purmerend → Middenbeemster 367
ijsboerderijdebuterkamp.nlIJsboerderij de BûterkampIJsboerderij de Bûterkamp is a farm ice cream shop located in Gaasterland offering homemade farm ice cream and various activities.Ice Cream → Ice Cream Manufacturers 45 boerengolf 13 ice cart 43 ice cream 1000 arrangement 3104 De Fryske Marren → Oudemirdum 73
hoteljoure.nlBoutique Hotel JoureThe website aims to promote Boutique Hotel Joure, a hotel in Joure, Friesland, and to offer boat rentals, providing information and booking options for guests.Hotels → Boutique Hotels 914 Accommodation → Breakfast 364 living room 1325 breakfast 1822 parking 1928 boat 2980 room 3411 hotel 3543 De Fryske Marren → Joure 689
fietshoekje.nlRijwielbedrijf ’t FietshoekjeThe website of 't Fietshoekje is a specialized shop in Oudemirdum that focuses on the sale of e-bikes and bicycles, and the rental of bicycles. It offers a wide range of bicycle brands and services.Bicycles → E-Bikes 243 Bicycles → City Bikes 65 e-bike 908 lease 1595 bicycle 2838 rental 7257 repair 14576 De Fryske Marren → Oudemirdum 73
tsjerke.nlTsjerkeThe website of Tsjerke presents a unique wedding venue in Friesland, offering various arrangements and facilities for couples looking for a romantic and all-inclusive wedding day.Hotels → Inns 114 Venues & Rentals → Venues 2044 venue 879 arrangement 3104 church 3439 hotel 3543 De Fryske Marren → Terherne 98
dierenambulancehoorn.nlDierenambulance Hoorn e.o.Dierenambulance Hoorn e.o. is a animal ambulance operating in West Friesland, providing transportation and first aid to animals in need.Education & Youth → Local Organization 65 Transportation → Emergency Services 630 call 204 veterinarian 864 driver 1832 animal 2908 volunteer 8367 Drechterland → Venhuizen 154
beachclublemmer.nlBeachclub LemmerThe Beach Club Lemmer website is a hospitality venue and meeting place on the Lemsterstrand in Lemmer, offering catering for both private events (such as weddings and corporate events) and business guests.Beach → Beach Pavilions 162 beach 3210 terrace 4847 package 6112 restaurant 11215 event 45199 De Fryske Marren → Lemmer 1188
sportwandelschool.nlSportwandelschool Hoorn / West-FrieslandThe Sportwandelschool Hoorn / West-Friesland offers training and travel opportunities in the areas of active walking, walking bootcamps, Nordic Walking and Skiken, with the aim of inspiring and helping people to stay active.Outdoor Adventures → Walking 1260 nordic walking 42 trip 2032 walk 2161 training 28133 Bergen → Schoorl 481
stichtingdbf.nlStichting DBFStichting DBF is a non-profit organization focused on improving the livability in Northern Netherlands by repurposing historic buildings.Historical Sites → Monuments 1027 Real Estate → Property Development & Redevelopment 153 redevelopment 93 vacancy 6598 property 7406 Waadhoeke → Oudebildtzijl 26
beachrockers.nlCreativeorangeThe website of the Beachrockers Festival presents information about the event taking place on July 4th and 5th, 2025, at Recreatiepark de Ulesprong in Sint Nicolaasga, including the lineup, tickets, practical information, and FAQs.Festivals → Music Festivals 1020 bus transportation 13 foodtrucks 182 lineup 267 ticket 2785 festival 3804 De Fryske Marren → Sint Nicolaasga 146
stienstrajoure.nlTegels & Sanitair StienstraTegels & Sanitair Stienstra is a specialist in Friesland that helps customers with the design and selection of bathrooms, tiles, and sanitary ware.Kitchen → Floor Tiles 130 Bathroom → Sanitary Ware 845 sanitary ware 669 tile 2869 bathroom 3784 showroom 4883 design 27202 De Fryske Marren → Joure 689
rondvaardij-princenhof.nlRondvaardij PrincenhofRondvaardij Princenhof provides luxury party boats and arrangements for various events.Water Travel → Boat Tours 640 Conferences & Meetings → Meetings 295 tours 1048 buffet 1747 boat 2980 arrangement 3104 event 45199 De Fryske Marren → Joure 689
mineralis.nlMineralisMineralis is a wholesale supplier of concrete, road, and water construction materials, offering a broad range of products and services.Commerce → Wholesale 1855 Construction → Civil & Infrastructure 3453 road 190 concrete 973 ship 5103 Oldebroek → Hattemerbroek 78
pglemmer.nlProtestantse Gemeente LemmerThe website of the Protestantse Gemeente Lemmer provides information about the church, its services, activities, team members, and policies.Reformed → Dutch Reformed Church 219 Religious Life → Local Congregations 31 faith 1093 policy 2149 church 3439 De Fryske Marren → Lemmer 1188
paviljoentmar.nlPavilion ‘t MarPavilion ‘t Mar is a hospitality venue located on 't Mirnser Klif in Friesland, offering guests a relaxing environment with food, drinks, and activities near the IJsselmeer and Rijsterbos.Events → Walking Tours 166 view 1045 walk 2161 food 3872 drink 5191 child 11566 De Fryske Marren → Mirns 22
cafedestam-joure.nlCafé de StamCafé de Stam is a meeting place in Joure offering a variety of activities and entertainment.Community & Social → Pub Quizzes 195 Neighborhood Focus → Community Centers 941 bingo 130 darts 307 billiard 341 cafe 1622 terrace 4847 performance 7586 De Fryske Marren → Joure 689
8501indie.nlStichting 8501indieThe Stichting 8501indie website promotes and fosters pop music and pop culture in Joure and the surrounding area.Live Music → Cover Bands 433 Performance → Pop Music 412 band 2977 video 6714 music 13170 De Fryske Marren → Joure 689
jantinahoeve.nlJantina HoeveThe website of Camping Jantina Hoeve presents a mini-camping in Friesland, located near lakes, forests and nature reserves, and offers camping opportunities for both longer stays and short breaks.Accommodation → Group Accommodation 844 Nature → Nature Reserves 1032 frisian lakes 14 nature reserves 23 minicamping 40 friesland 692 forest 1418 camp 2466 North-Holland → Amsterdam 41253
drogisterijhak.nlDrogisterij HakDrogisterij Hak is an apothecary and shop in Lemmer that offers a wide assortment, competitive prices, and expert advice.Pharmaceuticals & Medical Products → Pharmacies 1029 Local & Regional Products → Local Shops 245 store 3901 assortment 7799 price 8328 brand 17737 De Fryske Marren → Lemmer 1188
groencentrumwitmarsum.nlGroencentrum WitmarsumGroencentrum Witmarsum is a garden center located in Friesland, offering a wide range of garden plants, flowers, accessories, and catering options, as well as gift cards.Plants → Garden Plants 220 garden plants 66 vegetable garden 226 gift card 582 flowers 3248 restaurant 11215 accessories 12975 Southwest-Friesland → Sneek 1921
veenstra-joure.nlVeenstra Bedrijfsauto's Joure BVThe website of Veenstra Bedrijfsauto's Joure BV presents a current offer of new and used commercial vehicles and passenger cars, with a focus on the Joure region.Car Selling & Valuation → Passenger Cars 992 Automotive → Commercial Vehicles & Trucks 1981 car sale 61 commercial vehicle 326 showroom 4883 De Fryske Marren → Joure 689
veekro.nlVEEKRO BedrijfswagensThe website of VEEKRO Bedrijfswagens is the official IVECO dealer for West-Friesland and the surrounding region, offering a wide range of services related to IVECO commercial vehicles, including sales, maintenance, repair, and rental.Maintenance & Services → Truck Maintenance 69 Automotive → Commercial Vehicles & Trucks 1981 iveco 14 used vehicles 32 commercial vehicle 326 rental 7257 workshop 19325 maintenance 20093 De Fryske Marren → Lemmer 1188
woudagemaalloop.nlLoopgroep Lemsterland & Mijn zus en ik BootcampThe Woudagemaalloop is an annual running event in Lemmer, offering various distances and a kids’ run, designed to promote community fitness and recreation.Boating → Marinas 825 kidsrun 46 beachclub 83 run 800 volunteer 8367 De Fryske Marren → Lemmer 1188
terhernsterveer.nlStichting Terhernster VeerThe website of Stichting Terhernster Veer describes and promotes the electric ferry ‘Fietsa Versa,’ which provides a ferry connection between Terherne and Tersoalstersyl, a key connection for cyclists and pedestrians.Water Sports → Water Recreation 599 Student → Cycling Travel 17 ferry 179 cycling route 451 stichting 481 canal 507 schedule 2624 solar panels 4701 De Fryske Marren → Terherne 98
uwjachtmakelaar.nlWhite Whale YachtbrokersThe website of White Whale Yachtbrokers offers services related to the sale of boats, including yachts and motorboats, throughout Europe. The platform functions as a yacht broker and provides an overview of available boats and sales mediation.Marine & Watercraft → Shipping 654 Transportation → Commercial Services 134 docking 10 valuation 2697 boat 2980 sale 5930 De Fryske Marren → Lemmer 1188
wijmar.nlWijmar AutomaterialenWijmar Automaterialen is an automotive supply store in Enkhuizen, Netherlands, serving garages and other sectors with a wide range of products including tires, tools, batteries, and spray materials.Manufacturing → Coatings 504 Water Activity → Water Sports 2944 spray paint 10 battery 1751 tire 1975 tool 3907 De Fryske Marren → Lemmer 1188
dusonederland.nlDuso Nederland B.V.The website of Duso Nederland offers industrial vacuum cleaners, central extraction systems, and related equipment and services for various industries.Machinery & Repair → Machinery 1045 Maintenance & Repair → Industrial Maintenance 732 atex 35 vacuum cleaners 78 industry 1780 accessories 12975 De Fryske Marren → Joure 689
vanoverbeek.nlVan Overbeek MakelaarsVan Overbeek Makelaars is a real estate agency specializing in the sale, purchase, rental, and valuation of residential and commercial properties in the West-Friesland region.Real Estate → Commercial Property 1840 commercial property 469 listings 525 valuation 2697 mortgage 4564 property 7406 De Fryske Marren → Lemmer 1188
haicobouma.nlCube Store FrieslandThe website of Cube Store Friesland is a specialty shop selling racing bikes, gravel bikes, electric bikes, and children's bikes, as well as cycling clothing.Bicycles → E-Bikes 243 Cycling → Bicycle Parts 277 cycling clothing 16 bike 1541 inventory 1613 staff 3405 store 3901 De Fryske Marren → Oudehaske 49
museumvreeburg.nlWestfriese Folklore FoundationMuseum Vreeburg Schagen is a museum consisting of a restored historic farm and a carriage museum, depicting life around 1900 in West-Friesland.Urban History → Local History 1654 Museums → Regional Museums 390 exhibit 36 scavenger hunt 88 farm 2622 collection 7566 De Fryske Marren → Lemmer 1188
beachclubsneek.nlRestaurant Beachclub SneekRestaurant Beachclub Sneek is a restaurant and beach club located on the Sneekermeer, aiming to provide a relaxed atmosphere and a varied selection of food and drinks for individual visitors and groups.Beach → Beach Pavilions 162 Event & Party Venues → Beach Restaurants 210 sneekermeer 14 beachclub 83 restaurant 11215 child 11566 menu 13856 De Fryske Marren → Goingarijp 86
steegengamode.nlSteegenga ModeSteegenga Mode is a women's and men's fashion store offering a wide selection of clothing and accessories.Fashion & Lifestyle → Television Programs 56 Fashion → Men’s Fashion 690 fashion 2212 store 3901 clothing 9443 brand 17737 De Fryske Marren → Balk 224
sneekermeer.nlWaterrijck SneekermeerThe website of Waterrijck Sneekermeer presents a new marina area, Waterrijck Sneekermeer, on the Sneekermeer in Friesland, featuring houseboats, apartments, and a penthouse for sale. The aim is to inform and attract potential buyers and renters of this recreational form.Boating → Harbors 252 Water Recreation → Houseboats 36 penthouse 108 houseboat 130 mooring 153 marina 487 apartment 5088 De Fryske Marren → Terherne 98
citroenfriesland.nlStoeboThe website of Stoebo is a Citroën dealer and repair center located in Bolsward, Friesland, specializing in the sale of new and used Citroën cars, the provision of parts and repairs, and the offering of various automotive services.Used Cars → Cars For Sale 79 citroën 88 mot 806 part 5044 car 10865 repair 14576 De Fryske Marren → Lemmer 1188
tuincentrumgernell.nlTuincentrum GernellTuincentrum Gernell is a garden center in Lemmer offering a wide range of gardening supplies, plants, and accessories, including sods from their own nursery and a petting zoo.Law → Family 2909 Outdoor & Garden → Garden Shops 795 petting zoo 110 grass 238 plant 4509 garden 13129 De Fryske Marren → Lemmer 1188
overnachtenfriesland.nlCamping ‘Lyts mar Smûk’”The website of Camping ‘Lyts mar Smûk’ presents a peaceful campsite in Friesland, offering facilities, rental options, activities, and the possibility of staying in a B&B. The aim is to inform potential guests about the campsite and the surrounding area.Camping → Minicamping 246 Camping → Camper Sites 243 friesland 692 sanitary 750 b&b 1060 cycle 1906 campsite 2093 De Fryske Marren → Goingarijp 86
lytseknipke.nlPension 't Lytse KnipkePension 't Lytse Knipke is a pension located in Lemmer that offers rooms for rent with breakfast, a restaurant, and amenities such as terraces and bicycle rental.Accommodation → Pensions 46 bike 1541 parking 1928 room 3411 terrace 4847 restaurant 11215 De Fryske Marren → Lemmer 1188
descharren.nlB&B De ScharrenThe B&B De Scharren website presents a small hotel in Scharsterbrug offering guests a peaceful and indulgent experience, suitable for short vacations, weekend trips or business stays.AccommodationTypes → Other Accommodation 172 stay 702 peace 1113 breakfast 1822 room 3411 hospitality 3491 garden 13129 De Fryske Marren → Scharsterbrug 16
podiumgorter.nlPodium GorterPodium Gorter is a cultural center in Balk that organizes a program of concerts, lectures, and events.Institutions → Cultural Institutions 475 History → Social Sciences 10786 storm 56 podium 74 lecture 1624 ticket 2785 concert 4409 De Fryske Marren → Balk 224
internet-marketing-friesland.nlInternet Marketing FrieslandInternet Marketing Friesland is a company offering internet marketing services primarily in the Friesland region.Online Marketing → Affiliate Marketing 299 Business → Industry 36977 internetmarketing 71 google 192 cms 613 campaign 3428 blog 13392 De Fryske Marren → Balk 224
verdrietvandezuiderzee.nlOrkater and De LaweiThe website presents the music theater performance ‘The Sorrow of the Zuiderzee’, which takes place at the Afsluitdijk and explores the historical and ecological consequences of the dike construction.Travel & Exploration → Natural History 17 Theater → Musical Theater 307 zuiderzee 10 performance 7586 nature 9094 De Fryske Marren → Oudemirdum 73
rienk.nlRienk kantoor en inrichting JoureRienk kantoor en inrichting Joure is a office furnishing company that focuses on service, quality, and craftsmanship in the region of Friesland.Interior → Furnishing 89 Commercial Properties → Offices 773 furnishing 292 office 2898 rental 7257 furniture 8751 De Fryske Marren → Lemmer 1188
westfrieslandsew.nlHandbalvereniging Westfriesland SEWHandbalvereniging Westfriesland SEW is a sports club offering various sports categories and information for members, supporters, and sponsors.Handball → Handball Associations 37 handball 209 tournament 2476 sponsors 2642 youth 3126 member 10154 De Fryske Marren → Lemmer 1188
lekkerkoese.nlTrees & Dolf ZwagermanB&B Lekker Koese is a bed and breakfast located in Friesland, Netherlands, offering guests a welcoming accommodation and the opportunity to explore the surrounding area.Hiking → Trails 356 surroundings 463 friesland 692 b&b 1060 room 3411 hospitality 3491 De Fryske Marren → Lemmer 1188
langweerdermolen.nlLangweerdermolenThe Langweerdermolen website offers unique accommodation in a beautifully restored mill in Langweer, Friesland, allowing visitors to experience Dutch heritage and enjoy a tranquil environment.Historical Sites → Mills 229 Nature → Nature Reserves 1032 quay 15 mill 487 friesland 692 accommodation 4921 De Fryske Marren → Boornzwaag 17
koopzondageninfo.nlKoopzondaginfo.nlThe website provides an overview of shopping Sundays and shopping evenings in the Netherlands, including opening hours and tips.Commerce → Shopping Centers 1001 shopping sunday 22 province 518 opening hours 2953 relaxation 3968 shop 6483 home 7976 Oldambt → Winschoten 830
112westfriesland.nl112WestFriesland.nlThe website provides news and updates from the West-Friesland region, with a focus on traffic incidents, fires, and police reports.Government & Administration → Police 215 accident 330 incident 335 emergency service 372 fire 429 vehicle 3743 report 4551 Drechterland → Venhuizen 154
dakpannen-medemblik.nldakpannenhandel KoperThis website offers a wide selection of old, used, and new roofing tiles and related materials.Building & Materials → Roofing 2000 remnants 23 roofing tiles 80 fittings 130 ceramic 187 concrete 973 price 8328 De Fryske Marren → Lemmer 1188
ovs-skarsterlan.nlOndernemersvereniging SkarsterlânThe OVS is an entrepreneur’s association focused on promoting mutual trade and representing the interests of its members to the municipality.Investing → Cryptocurrency 776 Associations & Groups → Business Associations 1018 trade 553 interest 911 municipality 6837 member 10154 event 45199 De Fryske Marren → Sint Nicolaasga 146
arbeidsmakelaar.nlArbeidsmakelaarsArbeidsmakelaars is a matching agency that helps job seekers and employers find the right fit.Staffing & Recruitment → Technical Staffing 395 Employment & Labor → Employers 608 agency 944 employer 2383 job 2795 match 3471 vacancy 6598 Venlo → Tegelen 324
dorr.nlDörr JachtbetimmeringDörr Jachtbetimmering is a specialist in the application and maintenance of wooden teak decks for yachts.Woodworking → Sawmills 48 Maritime → Shipbuilding 568 teakdeck 17 wood 4153 ship 5103 maintenance 20093 De Fryske Marren → Lemmer 1188
fitstudiosayan.nlFitstudio Sayan BervoetsThe website of Fitstudio Sayan Oudehaske - Heerenveen provides information about outdoor, personal and indoor training, nutrition consultations, and an online shop. The aim is to inform potential customers and encourage them to participate in the training sessions.Fitness → Outdoor Fitness 109 Home → Outdoor 1446 outdoor 381 personal training 1271 online shop 1310 training 28133 De Fryske Marren → Oudehaske 49
numeppel.nlNumeppelThis website publishes local news reports about traffic accidents and other incidents in the region.Crime & Safety → Crime 356 News & Journalism → Regional News 948 highway 88 traffic accident 138 fire department 171 car 10865 news 15293 Staphorst → Punthorst 31
appelman-haarden.nlAppelman Haarden ArchitectuurThe website of Open Haarden Almere showcases Appelman Haarden Architectuur, a company specializing in the sale and installation of fireplaces, wood stoves, and gas-powered fireplaces.Heating → Fireplaces 578 wood stove 214 gas 434 chimney 523 fireplace 752 showroom 4883 De Fryske Marren → Lemmer 1188
dirkbons.nldirkbons.nlThis website is dedicated to the resistance efforts of the Bons family, particularly Dirk Bons and his son Ton, and their contribution to the Dutch liberation. The website also aims to commemorate other resistance activities and honor the victims of World War II.World War II → Dutch Resistance 18 Events → Places 1219 resistance 230 photo 7778 Schagen → Burgerbrug 29
trouweninfriesland.nlTrouwen in FrieslandThe website 'Weddings in Friesland' is a central information source and platform for couples planning their wedding in Friesland, Netherlands. It offers locations, suppliers, and practical tips for the entire wedding planning process.Weddings → Wedding Planning 677 Celebratory Occasions → Wedding Events 51 wedding dress 109 supplier 1725 wedding 4258 catering 6456 music 13170 Friesland → Tytsjerksteradiel 1035
luchtoorlogfriesland.nlStichting Missing Airmen Memorial FoundationThe website provides information and a database on aircraft crashes and casualties during the air war over Friesland between 1940 and 1945.Local History → Dutch History 1067 Specialized History → World War II 1134 descendants 48 aircraft 269 crew 320 Leeuwarden → Warten 81
wal-sloopwerken.nlVan der Wal Sloopwerken, Asbestsanering and RecyclingThe website of Van der Wal Sloopwerken, Asbestsanering and Recycling presents the company as a specialist in sustainable demolition, asbestos removal and recycling in Northern Netherlands, with a tradition of over 50 years.Environmental Technology → Asbestos Remediation 191 Building & Materials → Demolition 687 asbestos removal 134 recycling 1036 demolition 1144 certification 3380 Noordoostpolder → Emmeloord 1649
trips.nlVakantieBoekingen BVThe website offers information and books fun outings, such as family outings, weekend trips, and group activities, with a focus on destinations in the Netherlands and abroad.Family Activities → Outings 763 Corporate Events → Corporate Outings 878 outing 982 review 1888 destination 2580 arrangement 3104 Raalte → Luttenberg 532
manegegaasterland.nlManege GaasterlandManege Gaasterland is a community equestrian center providing facilities for riders and horses, featuring riding trails and events.Outdoor → Horse Riding 941 Equestrian → Stables 629 trail 151 rider 594 stable 768 box 1982 horse 4337 association 8562 De Fryske Marren → Harich 35
soesterdal.nlSoesterdalThe Soesterdal website is for a café-restaurant located in a historic pavilion on the former Soesterberg airbase, where visitors can enjoy food, drinks and a unique environment with a playground.Children’s Activities → Playgrounds 702 Events & Activities → Outdoor Activities 1043 view 1045 playground 1088 cake 1730 food 3872 restaurant 11215 De Fryske Marren → Sint Nicolaasga 146
handiginhout.nlHandig in HoutThe website of Handig in Hout in Joure offers custom interior construction and kitchen solutions.Kitchen → Custom Furniture 473 Kitchen → Kitchen Solutions 24 cabinet 1730 wood 4153 kitchen 6443 interior 8093 furniture 8751 design 27202 De Fryske Marren → Joure 689
dudinkmossel.nlDudink & Mossel Projectstoffering BVThe website of Dudink & Mossel Projectstoffering BV presents a wide range of flooring and window coverings, aimed at both commercial and private clients. The company offers custom solutions, advice, and complete project execution.Outdoor Living → Sun Control 85 Garden → Sun Shading 568 sun shading 835 window coverings 1213 floor 4781 maintenance 20093 De Fryske Marren → Lemmer 1188
hayobol.nlPraktijk Hayo BolThe website of Praktijk Hayo Bol presents itself as a naturopathic practice located in Joure and Amsterdam, specializing in diagnosing and treating various ailments using diverse complementary therapies.Alternative Medicine → Naturopathy 1097 Complaints & Symptoms → Symptoms 20 bioreasonance 44 orthomolecular medicine 62 test 769 scan 790 therapy 7448 De Fryske Marren → Joure 689
outdoorliving.nlWellness & OutdoorlivingThe website of Wellness & Outdoorliving in Joure offers a wide range of wellness products, including Jacuzzi® SunSpas, saunas, and swim spas, and is the largest wellness showroom in Northern Netherlands.Services → Hot Tubs 126 Spa → Saunas 920 swim spa 30 spa 355 sauna 1175 showroom 4883 accessories 12975 De Fryske Marren → Joure 689
zltenergie.nlZL T EnergyThe website of ZLT Energie is a specialist in solar energy, helping customers save energy and offer smart home solutions, including solar panels, home batteries, and an energy manager.Solar Energy → Storage Solutions 37 Energy → Energy Management 504 energy management 144 home battery 517 solar panels 4701 De Fryske Marren → Joure 689
bilstraverhuur.nlWatze Bilstra Balloons and Party RentalThe website of Bilstra Verhuur – Watze Bilstra Balloons and Party Rental offers attraction and party rental services, including balloons, party tents and furniture, with a focus on weddings, parties and events on location.Decoration → Balloon Decoration 39 Commerce → Rental Businesses 87 party tent 256 balloon 554 decoration 4085 wedding 4258 furniture 8751 event 45199 De Fryske Marren → Langweer 93
juweliersvergelijken.nlEdelsmid Rob KoenraadsThe website provides an overview of jewelers in the Netherlands, including location data and opening hours.Accessories → Jewelry 3517 Shops → Watches 655 jeweler 70 diamond 198 wedding rings 281 watch 1166 advertisement 1707 jewelry 4599 Heeze-Leende → Heeze 463
bertusdijkstra.nlBouw- en Molenbouw Bertus DijkstraBouw- en Molenbouw Bertus Dijkstra is a company specializing in the restoration and maintenance of historical buildings and windmills.Renewable Energy → Wind Energy 396 Business → Industry 36977 tower 188 windmill 249 machine park 642 door 2210 restoration 3417 Weststellingwerf → De Blesse 22
mythemakers.nlMythemakersMythemakers.nl is a website that organizes tabletop roleplaying games (TTRPGs), with a focus on storytelling and social gatherings around a table, including Dungeons & Dragons (D&D) and Friesian oneshots.Role-Playing Games → Dragons 19 dungeons and dragons 11 game master 11 player 678 story 8285 workshop 19325 De Fryske Marren → Lemmer 1188
renttourbuy.nlRentTourBuyThe website RentTourBuy offers bicycle rentals, city tours, and the sale of bicycles and accessories in the Hoorn and Andijk region, with a special focus on electric bikes and fat bikes.Cycling → Bicycle Rental 643 Bicycles → Electric Bicycles 402 bike rental 71 e-chopper 122 fatbike 143 guide 1364 tour 2315 bicycle 2838 Drechterland → Venhuizen 154
vrsvanvugt.nlVan Vugt VerkeersopleidingenVan Vugt Verkeersopleidingen is a driving school offering various driving lessons and traffic training, including for cars, motorcycles, scooters, and trucks.Driver & Vehicle → Driver’s License 1625 exam 2120 driving lessons 2453 instructor 3126 training 28133 De Fryske Marren → Lemmer 1188
pretparkacties.nlPretparkactiesThe website provides an overview of theme park tickets with discounts.Family Activities → Day Trips 419 Recreation → Theme Parks & Entertainment 8254 climbing park 22 amusement park 96 accommodation 4921 travel 7210 The Hague → Scheveningen 1625
jagertje-langweer.nlRestaurant 't Jagertje LangweerRestaurant 't Jagertje Langweer is a restaurant located in Langweer offering culinary experiences, particularly French cuisine, with options for lunch, dinner, accommodation and meeting rooms.Brasseries & Bistros → Bistro 594 Brasseries & Bistros → French Cuisine 146 lunch 1534 reservation 3373 wine 4476 accommodation 4921 restaurant 11215 menu 13856 De Fryske Marren → Langweer 93
bongerd.nlCapfunCapfun de Bongerd is a five-star holiday park in North Holland offering camping locations and luxurious accommodations for family holidays.Accommodation → Bungalow Parks 931 Agricultural Tourism → Holiday Accommodation 50 holiday park 566 animation 1777 camp 2466 facility 2616 accommodation 4921 De Fryske Marren → Lemmer 1188
zonmaat.nlZonmaatZonmaat is a specialist in installing solar panel systems for social housing, aiming to make sustainable energy accessible to everyone.Heating → CV Installation 134 Technical Services → Technical 957 solar panel system 10 solar energy 373 housing corporation 424 technician 815 installation 13742 Albrandswaard → Poortugaal 206
valkeringclassics.nlValkering ClassicsThe website of Valkering Classics offers classic cars and wedding cars for rent in North Holland, focusing on iconic American cars and discreet, West-Frisian service.Personal Transportation → Limousines 71 Car Rental → Classic Car Rental 21 cadillac 17 wedding car 105 classic car 404 chauffeur 452 wedding 4258 event 45199 De Fryske Marren → Lemmer 1188
ijbgroep.nlIJB GroepThe website of IJB Groep presents a complete solution for foundation work, with a focus on sustainable and circular solutions.Construction Technology → Foundation Technology 135 pile 39 prefabricated 69 soil investigation 80 foundation 6678 construction 7421 sustainability 18451 De Fryske Marren → Joure 689
passantenhavenlangweer.nlPassantenhaven LangweerThe Passantenhaven Langweer is a watersport harbor offering various facilities and opportunities to boats and visitors.Boating → Harbors 252 harbor 691 facility 2616 boat 2980 beach 3210 De Fryske Marren → Langweer 93
40mm.nl40MMThe website describes a sponsored walk event held annually in West Friesland to raise money for small-scale development projects in less developed countries.Social Issues → Social Organization 13315 Walking → Walking Events 137 west-friesland 41 sponsor 1159 walk 2161 donation 5110 De Fryske Marren → Lemmer 1188
kevelam.nlMunthandel Kevelam B.V.Munthandel Kevelam B.V. is a business that has been buying and selling coins, paper money, gold, and silver since 1979.Hobbies → Coin Collecting 18 euro 43 coin 313 silver 479 set 720 gold 805 De Fryske Marren → Lemmer 1188
fytt.nlFYTT Fysiotherapie HeerenveenThe website of FYTT Fysiotherapie Heerenveen offers physiotherapy, manual therapy, sports physiotherapy, and edema therapy, with a focus on personalized care and treating a variety of complaints. The goal is to promote a healthy lifestyle and treat physical ailments.Physiotherapy → Sports Physiotherapy 747 Physiotherapy → Specialized Physiotherapy 74 edema therapy 186 sports physiotherapy 436 manual therapy 1320 physiotherapy 4688 complaint 6479 appointment 13510 De Fryske Marren → Joure 689
nieuwsuitwestfriesland.nlXYTO Media B.V.The website Nieuwsuitwestfriesland.nl provides the latest news and information about the West Friesland region, including local events, business advertisements, job vacancies, and special topics.Blogs & Publications → Regional 272 Office & Workspace → Business Directory 32 traffic 916 advertisement 1707 municipality 6837 news 15293 event 45199 De Fryske Marren → Lemmer 1188
jaczitman.nlJac ZitmanThe website of Jac Zitman presents the paranormal practice and insights of Jac Zitman, a healer and mystic from Friesland, and offers natural remedies for sale.Women’s Health → Fertility 125 Mental & Emotional Well-Being → Anxiety 1169 fertility 289 hormone 563 herbs 924 insights 976 treatment 21203 Leidschendam-Voorburg → Leidschendam 1049
zic-weru.nlZic WeruThe website of Zic Weru is an online shop and showroom specializing in the sale and installation of plastic frames, doors, sun shading, and renovated skylights, with a focus on quality, sustainability, and minimal maintenance.Windows → Frames 1211 Insulation & Glazing → Insulation 1543 sun shading 835 door 2210 insulation 2448 frames 2556 showroom 4883 maintenance 20093 De Fryske Marren → Sint Nicolaasga 146
recreatieparkdejerden.nlRecreatiepark De JerdenRecreatiepark De Jerden is a recreation park located in Sloten, Friesland, offering vacations with camping, chalets, and various facilities.Water → Lakes 232 Camping → Campsites Netherlands 792 bistro 219 chalet 1264 camp 2466 facility 2616 Amsterdam → Sloten 146
frieslandontruimingen.nlFriesland DemolitionThe website offers services for home and business clearance (demolition).Family → Funeral Services 2084 clearance 349 commercial property 469 cleaning 4567 home 7976 quote 12863 Achtkarspelen → Surhuisterveen 281
online-marketing-friesland.nlTjeerd EngelThe Online Marketing Friesland website by Tjeerd Engel provides online marketing services in the Friesland region.Advertising → Online Advertising 948 advertisement 1707 seo 3707 marketing 7107 strategy 9379 De Fryske Marren → Balk 224
mateboer.nlMateboerThe website of Mateboer describes a family-owned company specializing in construction, project development, and environmental technology, with a focus on sustainability and a positive work environment.Building & Construction → Sustainable Building 1004 Real Estate → Project Development 633 environmental technology 27 housing development 130 project development 215 employee 4429 construction 7421 sustainability 18451 De Fryske Marren → Joure 689
wijbengagroep.nlWijbenga Architecten en AdviseursWijbenga Architecten en Adviseurs provides architectural and advisory services for various construction projects.Management & Consulting → Consultants 444 vision 1882 space 3846 construction 7421 design 27202 De Fryske Marren → Lemmer 1188
bv-quintas.nlBasketbalvereniging QuintasThe website of Basketbalvereniging Quintas introduces the association to potential members and visitors, and provides information about club activities and news.Team Sports → Basketball 244 basketball association 42 youth team 102 competition 4759 association 8562 member 10154 event 45199 De Fryske Marren → Lemmer 1188
graasboerderij.nlGraasboerderijThe website of Graasboerderij describes a farm that produces organic meat, dairy, eggs, and vegetables.Healthy Eating → Organic Food 219 Farms & Farm Businesses → Organic Farms 67 farm shop 204 dairy 274 egg 335 cow 596 meat 2055 De Fryske Marren → Sondel 14
inloophuispisa.nlStichting Inloophuis PisaInloophuis Pisa is a welcoming center in West Friesland that supports people with cancer and their loved ones, offering a listening ear, peer support, and various activities.Child Welfare → Support Organizations 270 Diseases → Cancer 546 peer support 68 meaning 428 cancer 631 counseling 741 De Fryske Marren → Lemmer 1188
vakantiekriebelsenvrijetijd.nlMedisch Pedicure Joure 40 VoetThe website of Medisch Pedicure Joure 40 Voet presents the services of a certified medical podiatrist, Gerrie Gerritsma, who cares for feet, particularly with conditions such as rheumatism, diabetes, and other foot problems, both in the practice and remotely.Foot Care → Medical Foot Care 710 Chronic Diseases → Diabetes 349 rheumatism 219 podiatrist 326 diabetes 750 sail 965 nails 1719 foot 1929 De Fryske Marren → Joure 689
desaunaspecialist.nlDe SaunaspecialistThe website of De Saunaspecialist presents and sells custom-made saunas, infrared cabins, and steam cabins, as well as related accessories and services.Garden → Swimming Pools 601 Spa → Saunas 920 infrared 89 steam 147 oven 324 sauna 1175 accessories 12975 De Fryske Marren → Joure 689
reijnoudthoveniers.nlReijnoudt HoveniersHoveniersbedrijf Reijnoudt Hoveniers is a gardening company based in Emmeloord, Netherlands, offering garden design, landscaping, renovation, and maintenance services, as well as machinery rental and plastic paving rental.Machine & Equipment → Machine Rental 192 Land Development & Earthworks → Earthmoving 643 machinery rental 26 paving stones 64 landscaping 1529 garden 13129 maintenance 20093 design 27202 Noordoostpolder → Emmeloord 1649
vakantiekoudum.nlVakantieKoudumVakantieKoudum is a website offering a holiday home in Koudum, Friesland, focused on providing a relaxing holiday experience in a natural environment with opportunities for water sports and other activities.Accommodation → Holiday Parks 1024 Accommodation → Bungalow Parks 931 lake 352 watersport 540 holiday home 2753 nature 9094 Southwest-Friesland → Koudum 134
dietisthestervisser.nlDiëtistenpraktijk Hester VisserThe website of Diëtistenpraktijk Hester Visser presents the services of a dietetics practice, focused on nutritional advice and dietetics, with special attention to children and sports nutrition. It also offers an online support option and information about the practice locations and the client portal.Nutrition → Dietetics 816 client portal 30 dietitian 299 nutritional advice 317 practice 9089 De Fryske Marren → Joure 689
dclemmer.nlStichting Diensten Centrum SeniorenThe Stichting Diensten Centrum Senioren is an organization that organizes various activities daily for seniors in Lemmer and its surroundings.Social Organization → Senior Organizations 750 Computer → Computer Support 1003 seniors 904 volunteer 8367 De Fryske Marren → Lemmer 1188
datstaatmeubelverhuur.nlDat Staat MeubelverhuurThe website ‘Dat Staat Meubelverhuur’ offers furniture rental services for various purposes, including sales styling, furnishing holiday homes, and projects, catering to both private and business clients.Logistics & Transportation → Rental Companies 414 furnishing 292 rental 7257 furniture 8751 quote 12863 De Fryske Marren → Joure 689
autoschadekuiper.nlAutoschade KuiperAutoschade Kuiper is an auto body repair shop specializing in the repair of auto and glass damage, offering additional services such as 3D alignment and calibration.Auto Parts & Tires → Wheels 545 Maintenance & Services → Auto Repair Services 794 auto damage 44 alignment 199 damage 1562 paint 8747 repair 14576 De Fryske Marren → Balk 224
strandinjehand.nl’t Oneindige VerhaalThe website describes and promotes the coffee table book 'Strand in je Hand,' featuring inspirational quotes from the coast of West-Friesland, now also available in Belgium.Electronics & Components → Books 30 Context 161394 west-friesland 41 luxury 375 photography 9503 book 11396 quote 12863 De Fryske Marren → Lemmer 1188
hazzeleger.nlDaltonschool 't HazzelegerThe website of Daltonschool 't Hazzeleger in Balk provides information for parents, students, and visitors about the school, including news, practical information, contact details, and information about education.Local Government → Municipality of Amsterdam 29 Primary Education → Dalton Schools 226 teacher 2890 parent 4318 student 7623 school 7856 education 13471 De Fryske Marren → Balk 224
kamermetontbijt.nlKamermetontbijt B.V.Kamermetontbijt.nl is a website designed to help users find and book bed and breakfasts (B&Bs) in the Netherlands and worldwide.Hotels → Boutique Hotels 914 Accommodation → Holiday Parks 1024 bed and breakfast 305 bookings 523 destination 2580 accommodation 4921 region 5412 Steenwijkerland → Vollenhove 207
fysio-actief.nlFysio-ActiefThe website of Fysiotherapie Fysio-Actief offers physiotherapy treatments and fitness options in Sneek, Bolsward and Joure, with a focus on recovery and an active lifestyle.Sports → General Sports 92 fitness 2251 lifestyle 2918 sport 4228 physiotherapy 4688 complaint 6479 treatment 21203 Southwest-Friesland → Sneek 1921
corverkammen.nlCorverkammenThe website offers services related to selling cars, including scrap cars and damaged cars.International Trade → Export 674 Driving & Lessons → Vehicles 541 damage car 38 auto 67 scrap car 127 pickup service 172 rdw 263 quote 12863 Drimmelen → Made 335
spaarnebazuin.nlDe SpaarnebazuinThe website of De Spaarnebazuin provides information about the association, its activities, repertoire, and members.Associations & Societies → Wind Bands 139 Orchestras & Bands → Orchestras 1553 orchestra 1315 repertoire 2497 concert 4409 drink 5191 member 10154 De Fryske Marren → Lemmer 1188
gebiedscontractmiddennoord.nlGebiedscontract Midden-NoordThe website of Gebiedscontract Midden-Noord informs visitors about the management and maintenance of waterways, roads, bridges, and other infrastructural elements in the Midden-Noord area.Civil & Infrastructure → Roads 252 Civil & Infrastructure → Water Works 168 waterway 120 road 190 bridge 557 work 3122 De Fryske Marren → Lemmer 1188
cyberveiligwestfriesland.nlCyberveilig West-FrieslandCyberveilig West-Friesland provides solutions and support for businesses and organizations in West-Friesland to protect themselves against cybercrime.Information Technology → Cybersecurity 1009 cybercrime 87 cybersecurity 688 presentation 1785 network 11123 De Fryske Marren → Lemmer 1188
pizzeriasardegna.nlPizzeria-Ristorante SardegnaThe website of Pizzeria-Ristorante Sardegna is an online platform for viewing the menu, booking a table, and ordering gift certificates, as well as providing information about the restaurant and contact details.Ice Cream → Ice Cream Parlors 521 pizzeria 76 gift certificate 646 family business 793 reservation 3373 foundation 6678 menu 13856 De Fryske Marren → Joure 689
frieslandautovoordeel.nlFriesland AutovoordeelFriesland Autovoordeel is an auto dealership specializing in used cars and offering them at attractive prices with delivery packages.Finance → Loans & Credit 1979 delivery package 10 occasion 2036 price 8328 car 10865 brand 17737 De Fryske Marren → Joure 689
plus2db.nlPlus2db StageFacilitiesThe website of Plus2db StageFacilities provides a wide range of services and products for organizing parties, festivals, and events, with a focus on lighting, sound, facility support, and entertainment.Property Rentals → Rental 1169 Camping → Facilities 199 stage 758 tent 1328 sound 1649 party 5928 catering 6456 performance 7586 De Fryske Marren → Oosterzee 29
gewichtsbeheersingvanatotz.nlGewichtsbeheersing van A tot ZGewichtsbeheersing van A tot Z is a webshop and coaching program providing personalized guidance to help users adopt a healthier lifestyle and lose weight.Diets → Low-Carb 26 Physical Fitness & Exercise → Weight Loss 1147 diet 747 nutrition 4935 goal 4974 coach 25810 Southwest-Friesland → Koudum 134
verhuizenoverzicht.nlVerhuizenOverzicht.nlThe website, verhuizenoverzicht.nl, provides an overview of moving companies in various regions of the Netherlands.Moving → Movers 272 Moving → Moving Companies 835 moving company 178 region 5412 quote 12863 Zwartewaterland → Genemuiden 405
audiolab.nlAudiolabAudiolab is a Dutch loudspeaker repair company providing repair services for businesses and individuals.Technical Services → Video Repair 10 loudspeaker 26 repair 14576 De Fryske Marren → Sint Nicolaasga 146
melchers-dejong.nlMelchers & de JongThe website of Melchers & de Jong presents a company specializing in upholstery and interior solutions for homes and vehicles.Furniture → Upholstery & Fabrics 1045 boat upholstery 12 upholstery 673 curtains 1015 screen 1438 floor 4781 furniture 8751 De Fryske Marren → Echtenerbrug 24
vanhartelief.nlGastouderbureau VanHarteLiefGastouderbureau VanHarteLief connects childcare providers with families in the Zwolle, Kampen and Emmeloord region, offering support in finding qualifications and subsidies.Childcare → Nanny Care 301 childcare provider 133 vegetable garden 226 theme 4015 child 11566 Noordoostpolder → Emmeloord 1649
de-rozemarijn.nlBloemisterij de RozemarijnBloemisterij de Rozemarijn is a flower shop offering bouquets, flowers, plants, home accessories and gifts, as well as occasion flowers.Florists → Traditional Florists 61 Garden → Garden Accessories 565 vase 550 bouquet 1147 flowers 3248 plant 4509 gift 6442 De Fryske Marren → Lemmer 1188
ijsvereniginglemmer.nlIJsvereniging LemmerThe website of IJsvereniging Lemmer provides information about the activities of the association, particularly around ice skating and natural ice, as well as events and news.Skating → Ice Rinks 475 ice track 19 time trial 20 ice skating 60 association 8562 event 45199 De Fryske Marren → Lemmer 1188
inuz.nlInuzInuz is a women's fashion boutique located in Friesland, Netherlands, offering clothing, shoes, and accessories both in physical stores and online.Clothing → Men’s Clothing 1008 Context 161394 shoes 2699 clothing 9443 accessories 12975 brand 17737 Achtkarspelen → Surhuisterveen 281
verkley.nlVerkley – Kabel & LeidingenThe website of Verkley – Kabel & Leidingen presents the services of a contractor specialized in the installation, maintenance, and connection of cables and pipelines for energy and water projects, with a focus on sustainability and safety.Audio → Cables 129 Infrastructure → Pipelines 50 pipeline 204 cable 732 water 2501 energy 9075 De Fryske Marren → Lemmer 1188
boskenwetter.nlVakantiehuis Bosk en WetterThe website 'Vakantiehuis Friesland: Vakantiehuis Bosk en Wetter' presents a holiday home for rent in Friesland, emphasizing its location, facilities (loungeboat, sloop, hot tub) and surroundings with recreational opportunities.Accommodation → Bungalows 1008 Cycling → Cycling Routes 1002 hot tub 260 river 312 farmhouse 878 holiday home 2753 boat 2980 De Fryske Marren → Balk 224
flevosiergras.nlFlevo SiergrasThe website of Flevo Siergras showcases a wide assortment of ornamental grasses and bamboos, and offers services for garden design and planting, with a focus on green roofs.Roofs → Green Roofs 145 Gardening → Plants 2867 ornamental grasses 22 green roof 217 garden 13129 Noordoostpolder → Bant 57
eszenzz.nlInstituut EszenzZThe Institute EszenzZ offers coaching, training courses and workshops for professionals, with a focus on high sensitivity (HSP), burnout prevention, and personal development.Parenting → Child Development 248 Coaching → Spiritual Coaching 743 hsp 175 training courses 224 burnout 1614 workshop 19325 coach 25810 De Fryske Marren → Lemmer 1188
vantiem.nlVan Tiem Elektro B.V.Van Tiem Elektro is an electrical company that offers solutions for various sectors including shipbuilding, construction, and utilities.Renovation & Restoration → Building Techniques 63 Installation & Mounting → Installation Methods 152 sustainable 739 electrical 1414 ship 5103 installation 13742 De Fryske Marren → Lemmer 1188
campingdetol.nlCamping de TolThe website of Camping de Tol in Koekange, Drenthe, presents the campsite as a nature camping with historical roots, located in a quiet and green environment, and offers facilities and activities for campers.Camping → Campsites Netherlands 792 campsite 2093 camp 2466 facility 2616 environment 4873 event 45199 De Fryske Marren → Echten 54
hetslauerhoff.nlUs Datsja RuigahuizenThe website 'Us Datsja Ruigahuizen' offers vacation homes for rent in Friesland, specifically in the location Ruigahuizen, Gaasterland, emphasizing a comfortable and well-maintained lodging.Accommodation → Bungalows 1008 Nature → Nature Lodges 32 vacation home 488 friesland 692 vacation 4234 De Fryske Marren → Ruigahuizen 13
taxihoorn-drechterland.nlTaxi Hoorn DrechterlandThe website of Taxi Hoorn-Drechterland offers taxi transportation for individuals and businesses in the West-Friesland region and beyond, with specialized services for airport and hospital transfers.Taxi & Ride Services → Taxi 1062 hospital 560 airport 789 driver 1832 taxi 2090 rate 2606 transportation 2851 De Fryske Marren → Lemmer 1188
electroboer.nlFA. GEBR. DE BOERThe website of FA. GEBR. DE BOER is an information platform that presents the services and projects of the company in the areas of electrical engineering, installation technology, and sustainable energy.Installation & Repair → General Installation 727 network cabling 15 sustainable 739 electricity 745 heat 2188 installation 13742 De Fryske Marren → Joure 689
8baan.nl8baan.nlThe website 8baan.nl collects and presents job vacancies offered by municipalities.Employment & Labor → Labor 504 role 234 hr 884 administration 6587 vacancy 6598 municipality 6837 De Fryske Marren → Joure 689
portunus.nlPortunusThe Portunus website in Terherne allows online ordering of breakfast, lunch, and dinner, as well as ice cream, desserts, and snacks. It is a bakery and restaurant located by the water.Sandwiches & Salads → Sandwich Shops 229 bakery 718 lunch 1534 breakfast 1822 sandwich 4098 order 6912 restaurant 11215 De Fryske Marren → Terherne 98
bureaudrugszaken.nlBureau DrugszakenBureau Drugszaken provides training programs and expertise to police, fire departments, municipalities, and housing associations, focused on recognizing and combating drug-related issues.Adult & Continuing Learning → Professional Training 1224 Government & Administration → Law Enforcement 55 drugs 105 police 480 municipality 6837 education 13471 training 28133 De Fryske Marren → Joure 689
westfrieseuitjes.nlEvent Agency Westfriese UitjesThe website Westfriese Uitjes offers a wide range of outings and activities in West-Friesland and North Holland, targeting businesses, families, and groups.Conferences & Meetings → Corporate Events 2472 company outing 166 outing 982 family 6462 event 45199 De Fryske Marren → Lemmer 1188
hydrowest.nlHydro WestHydro West is a hydraulic specialist dedicated to providing hydraulic systems, components, and services.Business → Industry 36977 Context 161394 aggregates 50 hose 185 cylinder 206 hydraulic 234 maintenance 20093 De Fryske Marren → Lemmer 1188
joustermerkeloop.nlAV HeerenveenThe website describes the Joustermerkeloop, an annual running race that takes place in Joure, Netherlands, and which will take place on the fourth Sunday of September.Walking → Walking Events 137 Running → Running Events 684 distance 270 race 1043 sponsors 2642 route 3425 volunteer 8367 De Fryske Marren → Joure 689
drukkerijendrukwerk.nldrukkerijendrukwerk.nlThe website provides an overview of printing companies and print shops in the Netherlands.Directories → Websites 3473 Design & Creative → Graphic Services 1003 printing companies 14 town 126 province 518 address 901 print 5511 Westerwolde → Blijham 62
dbs-balk.nlDBS-BalkThe website of DBS-Balk is a platform for the volleyball association DBS-Balk, providing information about the club, teams, news, events, and membership.Volleyball → Volleyball Associations 72 volleyball 617 sponsor 1159 membership 10442 event 45199 De Fryske Marren → Balk 224
frieschen.nlFrieschen BeddenFrieschen Bedden offers bespoke boxsprings, waterbeds and mattresses, focusing on modular design and ergonomic support.Beds → Boxsprings 229 Crafts → Traditional Crafts 37 waterbed 53 ergonomic 88 modular 160 boxspring 282 mattress 899 comfort 1473 De Fryske Marren → Joure 689
werktijdbv.nlWerktijd BVThe website of Uitzendbureau Werktijd is a platform that offers job vacancies and provides staffing services in Northern Netherlands.Employment & Labor → Labor Market 580 Education → Career & Guidance 1157 labor market 296 friesland 692 staff 3405 employee 4429 vacancy 6598 De Fryske Marren → Joure 689
wellnessvakantievilla.nlDe NotenkrakerThe website describes a luxury vacation villa, De Notenkraker, located on the Ijselmeer.Accommodation → Villas 1018 Accommodation → Bungalows 1008 hot tub 260 sauna 1175 villa 1351 forest 1418 terrace 4847 De Fryske Marren → Oudemirdum 73
rikostukadoors.nlRiko StukadoorsbedrijfThe website of Riko Stukadoorsbedrijf presents the services of a plastering company based in West-Friesland, with a focus on quality and experience.Plastering & Rendering → Stucco 210 Construction Companies → Plasterers 843 ornament 120 plaster 2175 restoration 3417 De Fryske Marren → Lemmer 1188
zaalverhuur-overzicht.nlZaalverhuurgidsThe website is an online directory for finding event venues in the Netherlands.Brasseries & Bistros → Brasserie 1005 Event Planning → Venue Rental 63 venue 879 reviews 3172 event 45199 Westerkwartier → Zuidhorn 286
voetbalgolffriesland.nlVoetbalgolf FrieslandThe website of Voetbalgolf Friesland is an informative and promotional website for the first football golf course in Friesland, located on the IJsselmeer, offering corporate outings and group activities.Corporate Events → Corporate Outings 878 Sport Facility → Golf 1441 course 14728 De Fryske Marren → Oudemirdum 73
zinmail.nlZinmailZinmail is a Dutch newsletter providing information and advertisements for workshops, courses, and events focused on personal development.Periodical Publications → Magazines 1001 Education → Tools 12 advertisement 1707 podcast 3328 course 14728 workshop 19325 event 45199 De Fryske Marren → Lemmer 1188
drentenderijk.nlDrent en de RijkThe website of Drent en de Rijk is a webpage of a plastering company that offers services for renovations, renovations, extensions and new construction projects, primarily focused on plastering walls and ceilings.Construction Companies → Plasterers 843 ceiling 627 wall 1378 plaster 2175 job 2795 renovation 13849 De Fryske Marren → Lemmer 1188
tweedehuisverkoopbemiddeling.nlTweedehuisVerkoopbemiddelingTweedehuisVerkoopbemiddeling is a real estate broker specializing in the sale and purchase of holiday homes in West-Friesland.Investing → Real Estate Investing 707 Property Valuation & Appraisal → Regional Real Estate Agents 454 buyer 233 holiday home 2753 market 2772 sale 5930 property 7406 De Fryske Marren → Lemmer 1188
verkeersschoolrnb.nlVerkeersschool R&BThe website of Verkeersschool R&B offers driving lessons in the Emmeloord area, with a focus on a quality and efficient driving education aimed at obtaining a driver’s license.Driving & Vehicle → Vehicle License 62 learning material 34 driver’s license 438 theory 956 driving lessons 2453 instructor 3126 practice 9089 De Fryske Marren → Lemmer 1188
devrouwenslagerij.nlThe VrouwenslagerijThe Vrouwenslagerij is an online shop and takeaway store specializing in gourmet meats, sausages, and related products such as bread, meat spreads, and wine, offering free delivery in the Netherlands from €25.Supermarkets & Grocery → Butchers 747 Supermarkets & Grocery → Food Stores 1058 sausage 256 barbecue 1175 bread 1622 meat 2055 wine 4476 assortment 7799 De Fryske Marren → Langweer 93
droommozaiek.nlHanneke KempffThe website of Hanneke Kempff showcases her mosaic work, including commissions, free work, and workshops, and offers an exhibition in Zoetermeer.Visual Arts → Mosaic Art 25 Crafts → Mosaic 32 mosaic 213 commission 609 work 3122 exhibition 5332 workshop 19325 De Fryske Marren → Echten 54
horrenexpert.nlHorrenexpert.nlHorrenexpert.nl is a specialist providing curtain and insect screens for various door and window types, emphasizing quality and craftsmanship.Windows → Screens 121 Interior → Window Coverings 1026 aluminum 1197 screen 1438 window 2030 door 2210 quote 12863 installation 13742 Northeast-Friesland → Dokkum 846
robertberger.nlRobert BergerThis website presents Robert Berger, a musician, pianist, and entertainer, providing information about his career, schedule, and unusual performances.Classical Music → Pianists 83 Popular → Rock 942 africa 150 pianist 291 piano 820 band 2977 concert 4409 performance 7586 De Fryske Marren → Joure 689
uitvaartshop.nlUitvaartshopThe website Uitvaartshop offers a wide selection of remembrance products, including urns and memorial jewelry, to permanently honor loved ones.Jewelry → Memorial Jewelry 60 Family → Funeral Services 2084 memorial jewelry 66 urn 411 De Fryske Marren → Oudehaske 49
uwopslagruimte.nlUwopslagruimte.nlThe website uwopslagruimte.nl offers various storage spaces for sale in the Netherlands, varying in location and size, with an emphasis on low prices, security, and easy access for the owner.Personal Finance → Savings 351 Real Estate & Investment → Real Estate 21471 storage space 388 unit 405 investment 2070 security 6655 price 8328 Hollands Kroon → Middenmeer 162
valkom.nlValkom VeilingenValkom Veilingen organizes and appraises movable goods, with a focus on online auctions and negotiated sales.Commerce → Auctions 157 lot 98 auction 561 appraisal 1488 inventory 1613 machine 3727 De Fryske Marren → Lemmer 1188
lemmer.nlMunicipality of LemmerThe website serves as a tourist information source for the municipality of Lemmer in Friesland, Netherlands, providing information and suggestions for hotels, restaurants, campsites, and attractions.Boating → Marinas 825 Local Life → Attractions 17 campsite 2093 holiday home 2753 hotel 3543 nature 9094 restaurant 11215 De Fryske Marren → Lemmer 1188
m-interieur.nlM-interieurThe website of M-interieur presents itself as a company offering custom-made cabinets and interior solutions, particularly in the region of Hoorn and West-Friesland.Kitchen → Custom Made 250 walk-in closet 21 bookshelf 69 dresser 79 workspace 795 cabinet 1730 interior 8093 De Fryske Marren → Lemmer 1188
verfboerlemmer.nlThe Verfboer LemmerThe Verfboer Lemmer is a paint specialist shop offering a wide range of paint products and related materials, both in the store and online.Building & Materials → Paint 923 wall paint 29 stain 122 paint 8747 brand 17737 De Fryske Marren → Lemmer 1188
pophop.nlPopHop Dutch Craft BeerThe website of POPHOP Dutch Craft Beer presents a selection of craft beers in combination with music, emphasizing the pairing of beer and music.Music → Genres 1752 Beverages → Beer 1095 packs 56 playlist 231 beer 2887 shop 6483 music 13170 Lingewaard → Bemmel 509
bantegaopscherp.nlBBB FryslânThe website provides information and updates regarding the potential location of a munitions depot in the village of Bantega, Friesland, and its impact on the local population.News & Journalism → Regional News 948 Governance → Politics 5458 defense 121 petition 223 resident 3245 De Fryske Marren → Bantega 19
leergeldzwf.nlStichting Leergeld Zuidwest FrieslandThe website of Stichting Leergeld Zuidwest Friesland provides information on how to apply for the school supplies pass, details about the organization, and updates on recent donations and activities.Support → School Support 171 Context 161394 school year 38 donation 5110 Friesland → Southwest-Friesland 4194
automotorenrevisie.nlPostma MotorenrevisiePostma Motorenrevisie is a company specializing in engine repair and parts, based in Balk.Maintenance & Services → Engine Maintenance 56 Repair → Engine Repair 129 engine repair 15 engine 758 part 5044 repair 14576 De Fryske Marren → Balk 224
schotererf.nlMinicamping SchotererfMinicamping Schotererf is a Bed & Breakfast campsite in Overijssel offering accommodation and facilities for guests.Campsites → Luxury Campsites 28 Camping → Minicamping 246 safari tent 128 caravan 1394 campsite 2093 accommodation 4921 De Fryske Marren → Lemmer 1188
douwsmamakelaardij.nlDouwsma Makelaardij VofThe website of Douwsma Makelaardij Vof is an online platform that offers real estate for sale and rent, as well as valuation services and contact information for potential buyers and tenants.Investing → Real Estate Investing 707 Real Estate & Investment → Real Estate 21471 premises 100 list 575 broker 902 valuation 2697 office 2898 property 7406 Southwest-Friesland → Sneek 1921
balloncentrum.nlNorthern Hot Air Balloon CenterThe Northern Hot Air Balloon Center is a company that offers professional hot air balloon rides in the north and provides the opportunity to buy tickets, schedule flights, and find information about hot air ballooning.Adventure → Hot Air Ballooning 93 hot air balloon 36 opportunity 581 flight 864 ticket 2785 price 8328 De Fryske Marren → Joure 689
bangapiramides.nlBanga PiramidesThe Banga Piramides website provides information about creating and selling pyramids made of wood and copper, with various applications and options.Geology → Minerals 108 pyramid 60 copper 145 wood 4153 webshop 8648 event 45199 De Fryske Marren → Balk 224
lemmernautic.nlLemmer Nautic JachtmakelaardijJachtbemiddeling Lemmer Nautic is a yacht brokerage that sells and brokers yachts in Jachthaven de Friese Hoek.Marine & Watercraft → Yachts 189 Real Estate & Investment → Real Estate 21471 brokerage 433 yacht 647 harbor 691 boat 2980 De Fryske Marren → Lemmer 1188
folkk.nlFolkkFolkk is a flexible event space and floral design location in Lemmer that provides services for events and offers a unique environment.Venues & Rentals → Venues 2044 floral design 48 ambiance 454 inspiration 4081 event 45199 De Fryske Marren → Lemmer 1188
triatlonwitmarsum.nlTriatlon WitmarsumThe website is a promotional page for the first edition of Run-bike-run Witmarsum, a event scheduled for May 18, 2025.Competitions → Triathlon 231 Running → Running Events 684 duathlon 12 participant 1934 results 3954 video 6714 event 45199 Achtkarspelen → Surhuisterveen 281
braaselektro.nlBraas ElektroBraas Elektro is an electrical installation company that provides services in North Holland and West Friesland, specializing in various installations and offering advice.Security → Intrusion Detection 137 alarm system 495 electrical engineering 817 light 5148 network 11123 installation 13742 Drechterland → Oosterwijzend 177
fbibv.nlFBI BVThe website of FBI BV is a specialist in the furnishing of company vehicles, providing complete solutions for design, delivery, and installation, including double cabs and interior panels, with a focus on organization, safety, and service.Rental Services → Fleet Management 257 company vehicle interior 12 fleet management 93 assortment 7799 De Fryske Marren → Lemmer 1188
jeroennan.nlNot MentionedThe website presents a short narrative about a man who receives a yearly phone call from his uncle J., without answering, and the cause of this recurring action is unclear.Personal Stories → Autobiography 222 Visual Arts → Folk Art 30 west-friesland 41 phone 1163 family 6462 story 8285 De Fryske Marren → Lemmer 1188
mbhc.nlMBHCThe MBHC website showcases plastic bridges and GVK composite structures, with a focus on renovation and repair projects. The company offers custom solutions and a full-service installation for the business market.Infrastructure → Viaducts 16 Infrastructure → Bridge 36 composite 194 bridge 557 profile 1965 quote 12863 installation 13742 Het Hogeland → Rottum 38
administratiekantoren-nederland.nlAdministratiekantoorgids B.V.The website provides an overview of accounting firms and bookkeeping offices in the Netherlands, offering location information, reviews, opening hours, and business registration opportunities.Finance → Taxation 1567 accounting firm 250 benefits 369 reviews 3172 Sittard-Geleen → Sittard 1997
kwantesgroenverzorging.nlKwantes GroenVerzorgingKwantes GroenVerzorging is a gardening maintenance company providing services in West-Friesland.Green Spaces → Green Maintenance 449 snow 126 lawn 427 gardening 505 tree 1879 gift 6442 maintenance 20093 De Fryske Marren → Lemmer 1188
huisdierarts.nlHuisDierArtsHuisDierArts is a veterinary practice offering consultations, vaccinations, and other animal healthcare services.Animals → Pets 1382 Animals → Veterinarians 813 vaccination 494 animal 2908 practice 9089 appointment 13510 De Fryske Marren → Oosterzee 29
brasserieanders.nlBrasserie AnderSThe website of Brasserie AnderS showcases the restaurant, its menu, organized events, and the option for reservations.Brasseries & Bistros → Brasserie 1005 Fine Dining & Gastronomy → Gastronomy 599 cooking workshop 168 play area 173 reservation 3373 restaurant 11215 menu 13856 event 45199 De Fryske Marren → Langweer 93
herfstzorg.nlHerfstZorgHerfstZorg is a private home care organization that provides customized care and support for seniors, with a focus on enabling them to continue living at home.Neurology → Dementia 509 Medical Care & Services → Home & Community Care 478 companionship 122 groceries 358 dementia 674 home care 827 administration 6587 care 12338 Sittard-Geleen → Sittard 1997
caravanstallingwijdenes.nlCaravanstalling WijdenesThe Caravanstalling Wijdenes website offers storage for boats on trailers or caravans, vehicles, and other objects in North Holland and West Friesland, located near Hoorn. The website provides information on costs, services, and appointment procedures.Caravans → Caravan Storage 145 Logistics → Storage 1170 caravan 1394 contract 2415 storage 2446 boat 2980 price 8328 appointment 13510 Drechterland → Wijdenes 46
medembliksdagblad.nlMedembliksdagblad.nlMedembliksdagblad.nl is a regional news website providing updates, events, and information about the Medemblik and West Friesland region.Regions → Regional Destinations 21 Tourism → Regional Information 91 festival 3804 municipality 6837 clothing 9443 news 15293 event 45199 De Fryske Marren → Lemmer 1188
calidus.nlCalidusThe Calidus website provides care, support, guidance, treatment and advice to elderly people and individuals with intellectual disabilities in West Friesland, with a focus on well-being and personal care.Care → Personal Care 592 Care → Residential Care 305 elderly care 128 housing 4378 care 12338 De Fryske Marren → Lemmer 1188
thuisinclientondersteuning.nlThuis in CliëntondersteuningThuis in Cliëntondersteuning provides independent and expert client support for individuals needing assistance with Wmo, Wlz, and Caregiving.Social Services → Client Support 59 Government & Administration → Legislation 432 client support 42 wlz 56 wmo 340 caregiving 368 care 12338 Friesland → Vlieland 518
aqua-state.nlAqua StateThe website, Vakantiehuis Huren Lemmer & Friesland, offers holiday homes for rent in and around Lemmer and Friesland, directly from owners, and provides supplementary services such as boat rental and access to various holiday parks.Accommodation → Holiday Parks 1024 SpecificDestinations → Travel in Netherlands 21 family holiday 16 lake 352 holiday park 566 bungalow 687 holiday home 2753 boat 2980 De Fryske Marren → Lemmer 1188
sinnergie.nlSinnergieSinnergie is a specialist in sustainable energy solutions, including air conditioning, charging stations, and home batteries, located in Friesland and surrounding areas.Solar Energy → Storage Solutions 37 Climate Control → Air Conditioning 1022 charging stations 421 home battery 517 air conditioning 2178 solar panels 4701 De Fryske Marren → Lemmer 1188
pollewops.nlPollewopsThis website presents a collection of trips, vacations, activities, and articles from Johan, Marion, and Rinske.Animal Care → Pet Sitting 57 pet 1617 cycle 1906 vacation 4234 article 6000 travel 7210 photography 9503 Amsterdam → North 657
dieetcompleet.nlDieet CompleetDieet Compleet is a specialist in nutrition and diets located in West Friesland, offering personalized treatments based on individual needs.Nutrition → Diets 951 Mental & Emotional Well-Being → Eating Disorders 199 nutrition advice 240 dietitian 299 diet 747 patient 4082 recipe 5142 treatment 21203 De Fryske Marren → Lemmer 1188
dietistingrid.nlDiëtistenpraktijk Ingrid Wiering-VriendDiëtistenpraktijk Ingrid Wiering-Vriend provides nutrition and diet counseling to patients in West-Friesland.Nutrition → Diets 951 Nutrition → Dietetics 816 condition 425 diet 747 nutrition 4935 practice 9089 appointment 13510 Drechterland → Venhuizen 154
eppiedam.nlEppie DamThe website provides information about Eppie Dam, a Dutch poet, writer, author of children's books, liturgical work creator, translator, and poetry artist.Freelancers → Writers 609 Fiction → Short Stories 311 short story 25 poet 158 writer 525 poetry 665 writing 1504 De Fryske Marren → Balk 224
wsv-stnic.nlWatersportvereniging Sint NicolaasgaThe website of Watersportvereniging Sint Nicolaasga provides information about the association, its facilities, events, and application procedures for berths and other services.Boating → Harbors 252 Water Sports → Watersport Associations 20 berth 341 harbor 691 facility 2616 event 45199 De Fryske Marren → Delfstrahuizen 47
caleyda.nlPHA2USE projectCaleyda’s website presents its natural biomaterial, produced from residual organics and microbes, as a sustainable alternative to plastics.Engineering → Materials Science 146 Plastics → Manufacturing 7708 biodegradable 29 composite 194 adhesive 244 3d printing 332 films 585 De Fryske Marren → Balk 224
drentheboertbewust.nlDrenthe Boert BewustThis website, Drenthe Boert Bewust, aims to connect farmers and growers with the general public in Drenthe.Agricultural Technology & Innovation → Sustainable Agriculture 278 grower 358 farmer 661 agriculture 778 news 15293 event 45199 Borger-Odoorn → Borger 288
hspbegeleidingnederland.nlInstituut EszenzZThe website provides an overview and search function for HSP guidance, coaches, and therapists in the Netherlands.Personality → High Sensitivity 28 Childcare → Child Therapy 205 hsp 175 therapist 1890 coach 25810 training 28133 Teylingen → Voorhout 426
airco-point.nlAirco-point.nlAirco-point.nl is an online shop specializing in the sale of climate products, including mobile air conditioners, air coolers, and fans.Climate Control → Air Conditioning 1022 fan 298 air conditioner 408 newsletter 6504 assortment 7799 De Fryske Marren → Joure 689
lyklamastate.nlLyklamastateThe Lyklamastate website is a B&B located in Nijemirdum, Friesland, offering guests a stay with activities, sights, and regional delicacies, with various accommodation options.Camping → Farm Camping 386 wellness 1561 breakfast 1822 farm 2622 accommodation 4921 De Fryske Marren → Nijemirdum 19
campingdevossenhoek.nlChalet & Caravanpark De VossenhoekChalet & Caravanpark De Vossenhoek is a campsite located in Gaasterland, Friesland, offering holiday enjoyment near the Rijsterbos and the IJsselmeer.Nature Reserves → Forest Areas 97 Camping → Campsites Netherlands 792 pond 686 harbor 691 forest 1418 campsite 2093 water 2501 De Fryske Marren → Sint Nicolaasga 146
zonderland-machinehandel.nlZonderland Machinehandel BVThe website of Zonderland Machinehandel BV showcases agricultural machines from the Zocon brand and provides information on the distribution of these machines in the BeNeLux region.Jobs → Vacancies 1099 Machinery & Repair → Machinery 1045 agriculture 778 catalog 812 work 3122 machine 3727 safety 5819 De Fryske Marren → Joure 689
friesland-huis.nlA. TolsmaThe website offers holiday homes for rent in the Fonteinbos Gaasterland, Friesland.Accommodation → Holiday Parks 1024 Accommodation → Bungalows 1008 walking route 340 golf course 507 friesland 692 holiday home 2753 home 7976 Amsterdam → Sloten 146
onthebox.nlOn the Box!On the Box! is a creative advertising agency specializing in advertising on pizza boxes, logo design, and art, featuring an online art gallery for local artists.Artists & Studios → Galleries 1398 advertising 2302 art 3856 logo 4660 marketing 7107 De Fryske Marren → Lemmer 1188
maronier.nlJachtwerf MaronierJachtwerf Maronier is a watersport business offering various services including refit, service, winter storage, and mooring spaces.Boating → Marinas 825 Water Activity → Water Sports 2944 refit 80 mooring 153 crane 662 engine 758 storage 2446 De Fryske Marren → Lemmer 1188
puurmondzorg.nlPUUR MondzorgPUUR Mondzorg is a group of dental practices in Northern Netherlands that offers a personalized care program and provides specialized services to promote the health of its patients.Dentistry → Specialties 378 Health → Medical Care & Services 29461 dental practices 14 care program 36 oral health 686 patient 4082 care 12338 treatment 21203 Northeast-Friesland → Dokkum 846
dassenhorst.nlstartplezier.nlThe website provides information and availability regarding a vacation home in Oudemirdum, Gaasterland, Friesland, with the possibility of booking and exploring the surrounding area.Accommodation → Bungalows 1008 Nature → Forest 387 vacation home 488 bungalow 687 vacation 4234 De Fryske Marren → Oudemirdum 73
kraammarkt.nlKraamMarktKraamMarkt is a platform that facilitates the employment of ZZP (self-employed) childcare providers and offers various services focused on optimizing their administrative and financial processes.Prevention → Contraception 92 International → International Business Services 51 placement 221 invoice 795 administration 6587 care 12338 De Fryske Marren → Joure 689
dezoetesnoet.nlDe Zoete SnoetThe website of De Zoete Snoet showcases a bakery specializing in creating custom cakes, cupcakes, and sweet tables, with a focus on delivery in Friesland and surrounding areas.Weddings → Wedding Cakes 69 Pastry → Cakes 826 sweet table 41 wedding cake 149 cupcakes 274 cake 1730 De Fryske Marren → Balk 224
benniehomma.nlB. HommaThe website of B. Homma presents information about his pigeon breeding records, performances, flight lines, and teletekst pigeons, focusing on the success of the pigeons and the experience of the fondman (long-distance flyer) Bennie Homma.Outdoor Activity → Pigeon Racing 203 pedigree 232 pigeon 284 flight 864 performance 7586 De Fryske Marren → Balk 224
vandeurzen-incasso.nlVan Deurzen Incasso Bedrijf & AdviesVan Deurzen Incasso Bedrijf & Advies provides business recovery and advisory services focused on improving customer payment behavior and optimizing credit management processes.Financial Management → Credit Management 46 Legal → Debt Collection 554 credit management 56 invoice 795 Berkelland → Borculo 347
hotelteernstra.nlHCR TeernstraHCR Teernstra is a hotel, café, restaurant, and catering service located in Balk Gaasterland, Friesland, offering hospitality and a nostalgic atmosphere.Cafes → Beer Cafes 209 Accommodation → Guesthouses 726 cafe 1622 water 2501 hospitality 3491 hotel 3543 catering 6456 restaurant 11215 De Fryske Marren → Balk 224
brouwerwoninginrichters.nlBrouwer WoninginrichtersBrouwer Woninginrichters is an interior specialist offering home furnishing, advice, and realization services in Flevoland and Friesland.Interior → Curtains 831 Decor & Furnishings → Home Stores 932 floor 4781 home 7976 interior 8093 De Fryske Marren → Lemmer 1188
campingelfbergen.nlCamping ElfbergenThe website of Camping Elfbergen in Gaasterland provides information about the campsite, its facilities, the surrounding area, and offered camping and accommodation options.Accommodation → Bungalow Parks 931 Parks & Gardens → Parks 1043 cabin 351 surroundings 463 campsite 2093 camp 2466 facility 2616 nature 9094 De Fryske Marren → Oudemirdum 73
broekzuid.nlBroek ZuidThe website of Broek Zuid presents a residential area in Friesland, specifically focused on building homes with direct access to the water and the Frisian Lakes.Urban Planning → Urban Development 378 Water Sports → Water Recreation 599 living 578 friesland 692 plot 1051 water 2501 house 8121 Tytsjerksteradiel → Earnewâld 117
notaristebalk.nlRiemersma NotariaatThe Riemersma Notariaat website provides legal services, primarily notary services, located in the town of Balk, Friesland, emphasizing a personal and accessible service.Legal → Notaries 848 deed 129 notary 791 mortgage 4564 real estate 4981 De Fryske Marren → Balk 224
kluger.nlKluger's Graveer- en SignbedrijfKluger's Graveer- en Signbedrijf is a company offering a wide range of advertising and graphic services including design, production, and assembly.Advertising → Lettering 569 Graphic & Digital Printing → Graphic Production 45 engraving 414 advertising 2302 production 4582 print 5511 webshop 8648 design 27202 De Fryske Marren → Lemmer 1188
joodsebegraafplaatstacozijl.nlStichting Joodse Begraafplaats TacozijlThe website of the Stichting Joodse Begraafplaats Tacozijl describes the foundation, its objectives, history, and provides information about the Jewish cemetery in Tacozijl.Religious History → Jewish History 25 Historical Sites → Monuments 1027 annual reports 311 cemetery 395 board 3438 foundation 6678 history 7286 De Fryske Marren → Lemmer 1188
elantraining.nlElan TrainingElan Training offers accredited training programs to become a certified job coach or career coach, focused on professional and personal development.Human Resources → Absence Management 850 Employment & Labor → Labor Market 580 job coach 53 education 13471 training 28133 De Fryske Marren → Rijs 32
leeflangmakelaardij.nlLeeflang Makelaardij BVLeeflang Makelaardij is a real estate agency focused on providing 24-hour contact and nationwide services, and will update its website and tools in 2016.Real Estate → Property Search & Listings 506 Real Estate → Regional Agencies 215 horizon 53 agency 944 appointment 13510 De Fryske Marren → Lemmer 1188
sreekers.nlInstallatie Techniek S Reekers BalkThe website of Installatie Techniek S Reekers Balk showcases the services of an installation company located in Balk, Friesland, specializing in sustainable installations and various installation work.Climate Control → Air Conditioning 1022 Climate Control → Cooling 585 electrical installation 264 sanitary 750 heat 2188 roofing 2806 installation 13742 sustainability 18451 De Fryske Marren → Balk 224
beautyplanet.nlBeauty PlanetBeauty Planet is a skin and laser clinic focused on professional skincare, skin improvement, and laser treatments for West-Friesland and surrounding areas.Primary Care → Clinics 1009 Cosmetic Procedures → Skin Rejuvenation 331 laser treatment 158 skin problems 220 skin rejuvenation 241 skin analysis 361 skincare 1972 De Fryske Marren → Lemmer 1188
pelletkachelshuis.nlPelletkachels Huis LemmerPelletkachels Huis Lemmer is a pellet stove dealer and service provider located in Lemmer, Friesland, offering a variety of brands and maintenance services.Heating → Pellet Stoves 95 pellet 117 pellet stove 182 showroom 4883 brand 17737 maintenance 20093 De Fryske Marren → Lemmer 1188
kingmawalinga.nlKingma & Walinga real estate agents and appraisers LemmerThe website of Kingma & Walinga real estate agents and appraisers presents a selection of properties for sale and rent, including appraisal reports and information about the real estate market in the municipalities of Lemmer and Makkum.Real Estate → Property Valuation & Appraisal 2123 Real Estate → Agricultural Real Estate 135 listings 525 transaction 613 appraisal 1488 property 7406 price 8328 De Fryske Marren → Lemmer 1188
inzetonline.nlInzet OnlineThe website of Inzet Online offers digital marketing services focused on driving business growth for its clients.Online Marketing → Google Ads 492 Marketing & Advertising → Strategy Consulting 37 revenue 693 results 3954 Westerkwartier → Opende 86
sellacq-holland.nlSELLACQ Holland B.V.Sellacq Holland is a company specializing in the supply of candle making supplies, wax products for the horticultural industry, and expert advice on paraffin and related products.Crafts → Candle Making 67 Agriculture → Horticulture & Floristry 1404 wax 711 candle 792 supply 961 De Fryske Marren → Joure 689
bozo.nlBozo Trappenbouw B.V.Bozo Trappenbouw B.V. is a company specializing in the design, production and installation of stairs and stair solutions.Construction & Renovation → Staircases 329 Industry → Industrial 1987 handrail 36 ladder 161 stair 815 De Fryske Marren → Balk 224
gaasterlandhuis.nlGaasterlandhuisThe website of Gaasterlandhuis offers a holiday house and recreation bungalow for rent in the Frisian village of Oudemirdum, located in Gaasterland, Friesland. It provides information about the property, the park, the surrounding area, and prices.AccommodationTypes → Accommodation 12130 holiday house 402 bungalow 687 recreation 799 De Fryske Marren → Oudemirdum 73
rdvtravel.nlRDV TravelRDV Travel is a travel agency specializing in organizing group trips, focusing on a stress-free and personalized experience.Balearic Islands → Mallorca 50 Germany → Harz 10 rollator 56 group trip 150 trip 2032 vacation 4234 accommodation 4921 Steenwijkerland → Kalenberg 178
tegelzetter.nlTegelzetter.nlThe website of Marco Nijholt tile company presents its services as a specialist in tile laying, especially Marazzi, and provides project examples and contact information.Renovation → Tiling 397 Finishing & Trades → Tile Installers 56 tile 2869 studio 5465 De Fryske Marren → Joure 689
zingendverbonden.nlChristelijk mannenkoor Zingend VerbondenThe website of the Christian men’s choir ‘Zingend Verbonden’ presents information about the choir members, agenda, and history of the choir, which was formed in 2020 through a merger of two male choirs.Choir → Men’s Choir 212 Religious Organizations → Protestant Organizations 114 merger 323 repertoire 2497 choir 3123 performance 7586 member 10154 De Fryske Marren → Joure 689
cecilia-catharina.nlCecilia CatharinaThe website of Cecilia Catharina Bed & Breakfast presents a charming stelpboerderij in Joure, Friesland, as a unique location for a vacation, focusing on peace, nature, and a glimpse into a dairy farm.Accommodation → Country Estates 738 Nature → Estates 771 dairy cows 23 grassland 71 bed and breakfast 305 accommodation 4921 nature 9094 De Fryske Marren → Joure 689
benbzusenzomer.nlB&B ZusenZomerB&B ZusenZomer is a Bed and Breakfast located in Oostwoud, West-Friesland, offering guests relaxation and a pleasant vacation experience.Accommodation → Overnight Stays 145 Landscape → Fields 16 guest accommodation 58 alpaca 113 hospitality 3491 relaxation 3968 environment 4873 house 8121 De Fryske Marren → Lemmer 1188
martienweel-uitvaartzorg.nlMartien Weel UitvaartzorgThe website of Martien Weel Uitvaartzorg in Hoorn offers funeral care and services to residents of Hoorn and West-Friesland, emphasizing personalized service, a small-scale approach, and tailored solutions within various budgets.Family → Funeral Services 2084 burial 406 cremation 615 cost 1990 funeral 2477 wishes 2717 Amsterdam → Nieuw-West 844
alamer.nlA la MerThe website of A la Mer describes a company that offers meeting rooms, flexible workspaces, and office spaces located on the IJsselmeer in Lemmer, targeting entrepreneurs and businesses.Beach → Beach Facilities 36 Commercial Properties → Offices 773 flexible workspace 85 meeting room 685 office space 773 networking 842 beach 3210 De Fryske Marren → Balk 224
tandartsenomdenoord.nlTandartsen om de NoordThe website of Tandartsen om de Noord offers information about a dental practice in West Friesland and invites new patients to register.Dentistry → Dental Hygienist 651 Context 161394 dental practice 181 dental care 311 parking 1928 dentist 2514 patient 4082 appointment 13510 Drechterland → Oosterwijzend 177
vriendinnenuitjes.nlVriendinnen UitjesThis website offers information and options for girls' outings.Activities → Excursions 257 Events → Weekend Getaways 106 friend 639 outing 982 destination 2580 quote 12863 The Hague → Scheveningen 1625
nationaleherdenkingjoure.nlStichting Nationale Herdenking JoureThe Stichting Nationale Herdenking Joure is dedicated to preserving memories of World War II and promoting awareness of the consequences of war.World War II → Battle of Arnhem 11 World War II → Remembrance 120 remembrance 165 war 272 monument 1168 history 7286 story 8285 education 13471 De Fryske Marren → Joure 689
aquasoft.nlAquasoft Service & Techniek B.V.The website of Aquasoft Waterontharders offers water softener products, advice, service and regeneration salt, aimed at private individuals, businesses and industry.Repair → Household Appliances 1226 water softening 19 water softener 324 Opsterland → Siegerswoude 31
degeeuw.nlRoeivereniging De GeeuwRoeivereniging de Geeuw is a rowing club based in Sneek that offers rowing and activities to its members and visitors.Water Sports → Rowing 303 Associations → Sports Associations 1082 rowing 243 water 2501 boat 2980 club 4225 member 10154 Southwest-Friesland → Heeg 227
nhngezond.nlNoord-Holland Noord GezondThe website Noord-Holland Noord Gezond aims to develop the region of North Holland North into the healthiest region of the Netherlands by 2030 through collaborative efforts in public health and living environment.Organizations → Society 767 Social Issues & Welfare → Social Affairs 601 challenge 1697 prevention 1763 resident 3245 region 5412 health 6366 collaboration 16036 De Fryske Marren → Lemmer 1188
autofirst-bosma.nlAutoFirst Autobedrijf BosmaAutoFirst Autobedrijf Bosma is an auto garage and lease company located in Sint Nicolaasga and Lemmer, offering maintenance, repairs, vehicle inspections, and used cars.Leasing → Private Lease 214 private lease 191 used car 825 garage 1210 repair 14576 maintenance 20093 De Fryske Marren → Sint Nicolaasga 146
dichtbij-accountants.nlDCHTBJ!DCHTBJ is an accounting firm specializing in SME businesses in Friesland, providing financial advice and services.Personal Finance → Financial Planning 1017 Accounting → General Accounting 939 figure 560 accountant 611 De Fryske Marren → Lemmer 1188
meiwurkje.nlMeiwurkje UitzendburoMeiwurkje Uitzendburo is an employment agency located in Joure, Heerenveen, and Lemmer, providing work and jobs throughout North Netherlands.Employment & Labor → Employers 608 Staffing & Recruitment → Temporary Staffing 1003 employment agency 78 temporary assignment 90 jobseeker 300 employer 2383 job 2795 vacancy 6598 De Fryske Marren → Lemmer 1188
lekkerbros.nlLekker BrosLekker Bros is a chocolatier and bakery that produces handcrafted chocolate and pastries using high-quality ingredients.Chocolate → Chocolatiers 96 chocolate 911 pastries 946 ingredients 2346 workshop 19325 De Fryske Marren → Joure 689
galerie-reinaerde.nlSplinter & De VoschThe website of Splinter & De Vosch presents a gallery for glass art, modern art and glass sculptures, located in Langweer.Visual Arts → Drawing 1046 Painting → Modern Art 99 gallery 1983 glass 2919 building 3204 space 3846 art 3856 paint 8747 De Fryske Marren → Langweer 93
dexrozen.nlDEX RozenDEX Rozen is a flower shop specializing in selling fresh roses and sympathy arrangements.Gifts & Occasions → Flower Shops 776 flower shop 35 sympathy arrangement 54 roses 214 assortment 7799 De Fryske Marren → Lemmer 1188
rondvaartsneek.nlRondvaartbedrijf M. van der WerfRondvaart Sneek offers boat trips and ship rentals in Friesland, focusing on exploring the Frisian lakes and local events.Water Travel → Boat Tours 640 lake 352 trip 2032 tour 2315 boat 2980 ship 5103 event 45199 De Fryske Marren → Lemmer 1188
theonebridal.nlThe One BridalThe website of ‘Bruidsmode Leeuwarden | The One Bridal’ offers a comprehensive selection of bridal wear and accessories for brides and grooms, with a focus on personalized service and inspiration for the wedding day.Weddings → Wedding Dresses 266 Context 161394 bridal wear 27 wedding suit 59 wedding dresses 98 inspiration 4081 accessories 12975 Northeast-Friesland → Dokkum 846
depalingfabriek.nlProef & Beleef de PalingfabriekThe website of ‘Proef & Beleef de Palingfabriek’ is an online presentation of a sustainable eel farm, delicatessen shop and webshop offering smoked eel, salmon and chicken. The website informs visitors about the company’s operations, opening hours and products.Cafes & Lunch → Lunchroom 446 Food → Local & Regional Products 930 smokehouse 11 eel 47 farm 2622 sandwich 4098 webshop 8648
mntstoker.nlMNT STOKERThe website of MNT STOKER presents audiovisual technology services for various corporate events, both physical and online.Electronics & Components → Audio 2351 Audiovisual & Media → Audiovisual Services 164 audiovisual technology 11 projection 59 stream 684 technician 815 presentation 1785 event 45199 De Fryske Marren → Joure 689
schilderindex.nlschilderindex.nlThis website, 'Schilder Index Nederland', provides an overview of painting companies in the Netherlands, with a focus on presenting the locations of painting companies throughout the country.Office & Workspace → Business Directories 421 painting companies 15 province 518 registration 4366 quote 12863 Land van Cuijk → Escharen 48
autojoureexport.nlAuto Joure Export XL bvAuto Export XL is a RDW-recognized company specializing in the export of cars for businesses and individuals.Road Services → Automotive 18764 Freight & Logistics → International Transportation 576 declaration 112 export 630 procedure 750 license 1288 car 10865 De Fryske Marren → Joure 689
koggeplaet.nlRecreatiepark de KoggeplaetRecreatiepark de Koggeplaet in Elahuizen offers accommodation and facilities on the Fluessen, focused on recreation and watersports.Vacations → Domestic Vacations 22 Accommodation → Bungalow Parks 931 recreation park 72 cottage 299 marina 487 Southwest-Friesland → Heeg 227
melancholieindepolder.nlTheatergroep Melancholie in de PolderThe website provides an overview of the dates and locations where the performance ‘Melancholy in the Polder 2’ will be performed by the duo Carel Kraayenhof and Leoni Jansen.Theater → Performances 649 Music & Performance → Music Events 758 date 1112 ticket 2785 performance 7586 De Fryske Marren → Balk 224
ijshazen.nlSchaatstrainingsvereniging De IJshazenThe website provides information about Schaatstrainingsvereniging De IJshazen, a skating association based in Zuidwolde, Netherlands.Skating → Marathon Skating 10 ice rink 265 skating 314 association 8562 membership 10442 training 28133 event 45199 Hoogeveen → Nieuweroord 35
lemsteraakkopen.nlLemsteraakkopenThis website provides information about the Lemsteraak VB130, a classic flat-bottomed boat that is for sale.Boats → Used Boats 10 Water → Boating 1592 lemsteraak 20 hull 63 sails 153 navigation 330 boat 2980 interior 8093 Friesland → IJsselmeer 593
tornadoyachting.nlTornado YachtingTornado Yachting Makkum is a dealer and importer of various yacht brands and offers rental and brokerage services.Marine & Watercraft → Yachts 189 Marine & Watercraft → Water Transportation 446 sailing yacht 58 motor yacht 64 brokerage 433 yacht 647 rental 7257 Southwest-Friesland → Makkum 229
opslagruimtelemmer.nlStorage Space LemmerThe website offers storage boxes and garage boxes for rent in Lemmer, Friesland and Emmeloord, with various sizes and prices.Logistics → Storage 1170 garage box 138 storage box 157 storage space 388 price 8328 De Fryske Marren → Lemmer 1188
campingpietersfarm.nlCamping Pieter's FarmThe website of Camping Pieter's Farm presents a farm camping located in the nature areas of De Rottige Meente and Weerribben, with a focus on tranquility, space, and nature for visitors.Nature → Natural Areas 257 Nature → Nature Reserves 1032 nature area 497 chalet 1264 camp 2466 boat 2980 Weststellingwerf → Munnekeburen 28
masteramiko.nlBasisschool SneekBasisschool Sneek, in collaboration with Master Amiko, provides education for young children in the Netherlands.Primary Education → Catholic Primary Education 380 Context 161394 school 7856 child 11566 education 13471 Southwest-Friesland → Sneek 1921
rodante.nlRodanteRodante provides culturally sensitive ambulatory and group support, focused on diverse target groups and contracts with municipalities.Social Services → WMO 162 Youth Development → Youth 1033 culture 3922 municipality 6837 care 12338 De Fryske Marren → Lemmer 1188
ijsclubhoogkarspel.nlIJsclub HoogkarspelThe website of IJsclub Hoogkarspel provides information about the history, activities, events, and contact details of the ice club, which has been active since 1888 in Hoogkarspel and organizes various activities.Ice Rinks → Ice Skating Clubs 218 ice club 38 ice skating 60 meeting 2381 news 15293 De Fryske Marren → Lemmer 1188
cfwf.nlCFWF Coöperatie Fysiotherapie West FrieslandThe CFWF Coöperatie Fysiotherapie West Friesland is a collaboration for physiotherapists in West Friesland, advocating for their interests.Sustainability → Cooperatives 970 physiotherapist 453 interest 911 prevention 1763 care 12338 collaboration 16036 Opmeer → Hoogwoud 149
vdbergbanket.nlV.d. Berg’s BanketbakkerijThe website of V.d. Berg’s Banketbakkerij in Hoorn offers an online shop where cakes, pastries, waffles, and tarts can be ordered. The website also provides information about the bakery, its history, opening hours, and delivery options.Pastries & Baked Goods → Organic Bread 86 waffle 218 bakery 718 pastries 946 cake 1730 assortment 7799 De Fryske Marren → Lemmer 1188
franskonijn.nlSnij- Voeg & Gevelrenovatiebedrijf Frans KonijnThe website of Snij- Voeg & Gevelrenovatiebedrijf Frans Konijn showcases the services of a company specializing in facade and joint renovation, with 35 years of experience in West-Friesland.Renovation → Facade Renovation 279 Masonry & Plastering → Masonry 576 competence 27 facade renovation 130 joints 155 impregnation 187 customer satisfaction 528 De Fryske Marren → Lemmer 1188
biggig.nlBiG GiGThe website of BiG GiG presents the Wognum Bigband, its repertoire, members, and performances.Jazz → Big Band 104 Instrument → Trumpet 25 arranger 61 bigband 122 musician 1207 conductor 1217 repertoire 2497 performance 7586 Medemblik → Wognum 185
bouwbedrijfruyter.nlBouwbedrijf RuyterBouwbedrijf Ruyter is a construction company based in Zwaagdijk that specializes in new construction, renovation, and remodeling projects.Interior Design → Interior Advice 331 wishes 2717 atmosphere 5591 construction 7421 interior 8093 house 8121 Purmerend → North-Beemster 27
pakraspirit.nlPakra SpiritPakra Spirit offers spiritual services, including readings, mediumship, healing, and coaching, to visitors in the region.Spirituality → Mediumship 535 Spirituality → Tarot 258 shamanism 169 mediumship 227 reading 784 healing 1148 coach 25810 Schagen → Tuitjenhorn 382
moondayyachts.nlMoonday YachtsThe website of Moonday Yachts showcases a range of handcrafted sportboats, sloeps (small boats), and motor yachts, focusing on high-quality materials and an attractive price-to-value ratio.Water → Boats 935 motorboat 128 sloop 272 yacht 647 brochure 1642 De Fryske Marren → Lemmer 1188
snikke.nlStichting Snikke ‘Johannes Veldkamp’The website provides information about the historic ‘Snikke Johannes Veldkamp’ barge, which is used for excursions in South East Drenthe, and offers booking options.Water Travel → Boat Tours 640 Activities → Excursions 257 bog 11 stichting 481 excursion 662 De Fryske Marren → Lemmer 1188
eilanderij.nlEilanderij KolhornEilanderij Kolhorn is a bistro and takeaway restaurant located in the village of Kolhorn, West Friesland, offering a place to eat, drink, shop, and enjoy a relaxed atmosphere.Accommodation → Country Estates 738 Brasseries & Bistros → Bistro 594 bistro 219 village 808 pizza 4158 wine 4476 terrace 4847 restaurant 11215 De Fryske Marren → Lemmer 1188
itdoarphuzum.nlVriendenclub Huzumer Skûtsje FoundationThe website ‘It Doarp Huzum’, operated by the Vriendenclub Huzumer Skûtsje Foundation, presents information about the traditional Frisian sailing vessel ‘It Doarp Huzum’, including news, history, race reports, and opportunities for sponsorship and rental.Sailing → Traditional Sailing 19 Local & Regional → Regional Events 821 skûtsje 57 race 1043 sponsorship 2686 history 7286 news 15293 event 45199 Leeuwarden → Grou 366
villabnbbovenkarspel.nlJennifer and RichardVilla B&B Bovenkarspel offers a luxurious and comfortable accommodation option in West Friesland, catering to guests seeking a unique experience.Accommodation → Beds 228 Context 161394 stay 702 villa 1351 breakfast 1822 room 3411 garden 13129 De Fryske Marren → Lemmer 1188
kbo-fryslan.nlKBO FryslânKBO Fryslân is a volunteer organization dedicated to advocating for seniors in Friesland and organizing activities for its members.Social Organization → Senior Organizations 750 Social Services → Welfare 1001 branch 268 seniors 904 interest 911 volunteer 8367 Southwest-Friesland → Sneek 1921
bioversmarkt.nlBioversmarktBioversmarkt is an online webshop and physical store offering fresh, organic products directly from local farmers.Produce & Vegetables → Vegetables 1070 Food → Supermarkets & Grocery 3568 dairy 274 fruit 1166 vegetables 1416 plant 4509 webshop 8648 De Fryske Marren → Lemmer 1188
sybox.nlSyboxSybox is a self-storage company located in Joure offering various storage solutions for businesses and individuals.Logistics → Storage 1170 shipping container 15 move 1441 box 1982 storage 2446 rental 7257 De Fryske Marren → Joure 689
rijschoolsteltenpool.nlRijschool SteltenpoolRijschool Steltenpool offers driving lessons in West-Friesland with a personalized approach and an experienced driving instructor.Driver’s License → Theory 333 pass rate 198 driving instructor 252 driver's license 1283 driving lessons 2453 schedule 2624 De Fryske Marren → Lemmer 1188
apollo68.nlApollo '68The website of Apollo '68 serves as an information source for members, potential members, and interested parties regarding the football club, its activities, events, and news.Football → Dutch Football Associations 58 Team Sports → Korfbal 406 sportpark 75 match 3471 club 4225 member 10154 news 15293 De Fryske Marren → Lemmer 1188
kramersbouwbedrijf.nlKramer's Bouwbedrijf B.V.Kramer's Bouwbedrijf B.V. is a construction company specializing in timber frame construction and various building projects, including new construction, renovations, and expansions.Wood & Timber → Timberwork 1596 Renovation & Restoration → Interior Renovation 879 timber frame construction 113 garage 1210 new construction 2672 house 8121 renovation 13849 De Fryske Marren → Sint Nicolaasga 146
driesenverhuizingen.nlDriesen VerhuizingenDriesen Verhuizingen is a recognized moving company providing moving and storage services in the Emmeloord region and surrounding areas.Logistics → Storage 1170 Moving → Moving Companies 835 move 1441 storage 2446 Noordoostpolder → Emmeloord 1649
autoenbandenservicederee.nlAuto- and Bandenservice De ReeThe website of Auto- and Bandenservice De Ree offers car dealership services such as repair, maintenance, tire service, car sales and an APK (vehicle inspection) service, with an emphasis on trust, craftsmanship and a comfortable customer experience.Tires → Tire Service 931 Repair → Garage 1779 waiting room 60 apk 1333 tire 1975 newsletter 6504 car 10865 repair 14576 De Fryske Marren → Sint Nicolaasga 146
benb7dehemel.nlB&B 7de HemelThe website of B&B 7de Hemel is an online platform where guests can find information and book a stay in a bed & breakfast in Hemelum, Friesland. It provides details about the facilities, arrangements, and surrounding area of the B&B.Accommodation → Breakfast 364 Accommodation → Beds 228 bike 1541 breakfast 1822 arrangement 3104 room 3411 hospitality 3491 garden 13129 Southwest-Friesland → Hindeloopen 127
bandb-toldewief.nl‘t Olde Wief B&B't Olde Wief is a Bed and Breakfast located in Friesland, offering a relaxing and peaceful stay near natural areas and historical towns.Cycling → Cycling Holidays 295 Places → Towns 380 welcome 23 town 126 park 1863 cycle 1906 walk 2161 nature 9094 Almelo → Schelfhorst 28
hetnoordend.nlHet Noordend B&BBed & Breakfast Het Noordend is a bed and breakfast located in Hoogwoud, West-Friesland, Netherlands, offering countryside accommodation in a rural setting with fields and nature.Landscape → Fields 16 west-friesland 41 tulip 267 bed and breakfast 305 room 3411 nature 9094 De Fryske Marren → Lemmer 1188
villakim.nlVilla KimVilla Kim is an Airbnb accommodation in Balk, Friesland, offering a relaxing stay and an unforgettable experience.Accommodation → Guesthouses 726 Accommodation → Airbnb 22 airbnb 27 holiday house 402 b&b 1060 center 1115 water 2501 garden 13129 De Fryske Marren → Balk 224
aninamulder.nlAnina Mulder PRI & consciousness coach RuigahuizenThe website of Anina Mulder is an online platform where a consciousness coach and Past Reality Integration therapist, based in Ruigahuizen, Friesland, helps young people overcome fears, depression, and stress, and guides them towards a happier and more loving life.Mental & Emotional Well-Being → Psychotherapy 685 Mental & Emotional Well-Being → Trauma 1001 equine coaching 29 fear 268 depression 408 life 2673 therapy 7448 De Fryske Marren → Ruigahuizen 13
solarvergelijking.nlSolarvergelijkingThe website, Solarvergelijking, is a solar panel installer in the Netherlands that helps visitors compare solar panels and request a quote. The goal is to encourage the transition to sustainable energy.Installation & Mounting → Installers 1007 solar panels 4701 energy 9075 quote 12863 installation 13742 maintenance 20093 De Fryske Marren → Balk 224
speckerselfstorage.nlSpecker Self StorageThe website of Specker Self Storage presents a self-storage service in West Friesland, aimed at both private and business customers who need additional storage space.Logistics → Storage 1170 storage space 388 lift 445 box 1982 security 6655 price 8328 De Fryske Marren → Lemmer 1188
velojoure.nlStichting Vélo JoureThe website of Stichting Vélo Joure describes and organizes the annual 16 Dorpentocht, a cycling event that raises money for the Villa Joep foundation.Walking → Walking Competitions 182 Walking → Walking Events 137 participant 1934 sponsors 2642 route 3425 foundation 6678 volunteer 8367 De Fryske Marren → Joure 689
geboortehart.nlGeboortehartThe Geboortehart website provides information about childbirth care in the Waterland and West-Friesland region, and offers information on pregnancy, childbirth, and the support of expectant parents.Medical Care & Services → Pediatric & Child Health 2121 Health → Pregnancy & Childbirth 4222 pediatrician 17 midwife 553 childbirth 894 pregnancy 2739 care 12338 De Fryske Marren → Lemmer 1188
cawf.nlCooperative Pharmacy Association of West FrieslandThe Cooperative Pharmacy Association of West Friesland (CAWF) is committed to promoting safe and comfortable medication use for the residents of the West Friesland region.Primary Care → Health Centers 409 Pharmaceuticals & Medical Products → Pharmacies 1029 pharmacist 62 pharmacy 702 medication 1164 healthcare 2316 De Fryske Marren → Lemmer 1188
dtvsprings.nlDTV SpringsThe website DTV Springs NL is a company specializing in the production, supply, and service of technical springs, with a long history and a focus on custom solutions and quality.Trade → Technical Trade 197 Audio → Components 489 spring 113 customization 1723 automation 2682 production 4582 price 8328 De Fryske Marren → Sint Nicolaasga 146
bangmabv.nlAannemingsbedrijf BangmaAannemingsbedrijf Bangma is a construction company based in Friesland, Netherlands, offering a range of construction services.Local & Regional Focus → Local Businesses 1077 Sustainable Building → Construction Projects 823 housing construction 125 construction company 824 maintenance 20093 De Fryske Marren → Sint Nicolaasga 146
helpinghands.nlHelping HandsHelping Hands provides personalized home care services and support in Northern Netherlands, focusing on individual needs and tailored solutions.Social Services → WMO 162 Special Needs & Support → Support 2006 family support 23 household assistance 90 indication 164 situation 655 care 12338 Noordenveld → Roden 621
klusbedrijfettema.nlKlusbedrijf EttemaKlusbedrijf Ettema is an all-round handyman business offering a wide range of services for homes and gardens.Renovation → Roof Renovation 430 Interior → Bathroom 1746 skylight 966 sauna 1175 carpentry 2218 bathroom 3784 kitchen 6443 paint 8747 De Fryske Marren → Balk 224
prfm.nlPRFM ParfumThe PRFM Parfum website offers a unique experience for finding and refilling your perfect perfume.Applications → Apps 435 refill 59 scent 333 perfume 534 pharmacy 702 Tytsjerksteradiel → Hurdegaryp 114
zelfmanegement.nlStichting Zelf Manege-mentThe website of Stichting Zelf Manege-ment provides a social meeting place and guidance for people with physical disabilities, focusing on independence and personal development.Social Services → Welfare 1001 meeting place 76 disability 594 goal 4974 coach 25810 De Fryske Marren → Joure 689
deblondebouwbegeleiding.nlDe Blonde Bouwbegeleiding B.V.De Blonde Bouwbegeleiding B.V. provides construction supervision and support services to businesses and individuals in the Netherlands.Project Management → Construction Management 1038 Project Management → Construction Supervision 364 building 3204 construction 7421 maintenance 20093 De Fryske Marren → Scharsterbrug 16
weero.nlWeero.nlThe website Weero.nl provides a Dutch and worldwide weather service, including daily and 10-day weather forecasts.Earth Sciences → Meteorology 54 Climate → Weather 411 radar 105 forecast 119 temperature 395 weather 817 Schagen → Burgerbrug 29
mini-koelkasten.nlMini-koelkasten.nlMini-koelkasten.nl is an online store that sells small refrigerators, mini wine coolers, small freezers and coolers, as well as parts and accessories from various brands.Household Appliances → Refrigerators 149 payment service 16 refrigerator 475 quote 12863 brand 17737 De Fryske Marren → Joure 689
silence.nlSilence Nederland BVThe website showcases and sells electric vehicles, including scooters, microcars, and electric mobility cars, under the Silence Nederland brand.Automotive → Sales 1205 Fuel & Energy → Electric Vehicles 1212 microcar 40 dealer 757 scooter 1236 battery 1751 subscription 3287 De Fryske Marren → Sint Nicolaasga 146
staatmakelaars.nlStaat MakelaarsStaat Makelaars is a real estate agency located in Almere, assisting clients with the sale and purchase of properties.Property Sales → Selling 89 agent 1253 valuation 2697 technology 6816 marketing 7107 house 8121 De Fryske Marren → Lemmer 1188
bloemenparadyske.nlBloemenparadyskeBloemenparadyske is a location where visitors can pick their own flowers, stay overnight, and find local products and sustainable gifts.Nature → Estates 771 AccommodationTypes → Garden 13 campsite 2093 flowers 3248 coffee 3838 vacation 4234 gift 6442 garden 13129 De Fryske Marren → Terkaple 24
dewigwam.nlCamping de WigwamThe website of Camping de Wigwam presents a family campsite in Oudemirdum, located in the forests of Gaasterland, focusing on nature, relaxation, and recreation.Camping → Family Campsites 71 playground 1088 bread 1622 cycle 1906 campsite 2093 accommodation 4921 De Fryske Marren → Oudemirdum 73
deijsfabriekjoure.nlDe ijsfabriek & chocoladeThe website of De ijsfabriek & chocolade in Joure presents their ice cream and chocolate assortment, offers online ordering, and describes the location and contact information.Chocolate & Sweets → Ice Cream 774 chocolate 911 ice cream 1000 shop 6483 De Fryske Marren → Joure 689
rijsterbosch.nlB&B RijsterboschB&B Rijsterbosch is a luxurious Bed & Breakfast and Belgian bistro located in Rijsterbosch, Friesland, offering guests a tranquil accommodation, meals, and packages.Tea → High Tea 90 Brasseries & Bistros → Brasserie 1005 high tea 585 brasserie 752 b&b 1060 room 3411 package 6112 De Fryske Marren → Rijs 32
tekstenuitleg.nlText and ExplanationThe website of Text and Explanation offers design services, including spatial, graphic, and multimedia designs for businesses and cultural institutions.Museums → Exhibition Design 26 Architecture & Design → Creative Industries 1157 graphic 74 multimedia 116 museum 2002 portfolio 6854 design 27202 Zaanstad → Wormerveer 530
manage2escape.nlManage2escapeManage2escape is a website offering historical outdoor escape games.Games → Escape Rooms 410 Activities → Scavenger Hunts 19 mission 1000 tour 2315 De Fryske Marren → Lemmer 1188
beachsuite.nlBeach Suites LemmerThe website Beach Suites Lemmer presents accommodation located on the beach of Lemmer, targeting both families and business guests, offering comfortable suites and a convenient location.Hotels → Apartment Hotels 39 Hotels → Beach Hotels 112 suite 215 stay 702 beach 3210 hospitality 3491 De Fryske Marren → Lemmer 1188
debraamberg.nlCamping de BraambergThe website of Camping de Braamberg presents a farm camping in Gaasterland, located on the IJsselmeer and Rijsterbos, offering campsites and facilities for campers.Camping → Campsites Netherlands 792 Nature → Cycling 472 toilet building 10 camper pitch 79 wifi 1372 campsite 2093 De Fryske Marren → Rijs 32
uswetterpleats.nlFamily Van der VeldeThe website of Camping Ús Wetterpleats Terherne presents a small-scale farm campsite on the Frisian waterways, aimed at guests seeking peace, greenery, and amenities.Camping → Farm Camping 386 Water Sports → Water Recreation 599 waterway 120 pitch 332 watersport 540 campsite 2093 vacation 4234 De Fryske Marren → Terherne 98
camperplaatspontdyk.nlCamperplaats PontdykCamperplaats Pontdyk is a camper site located in Boornzwaag, Friesland, offering visitors the opportunity to stay and enjoy the surrounding area.Camping → Camper Sites 243 Camping → Campsites Netherlands 792 frisian lakes 14 pier 58 camper site 126 friesland 692 bag 2399 De Fryske Marren → Boornzwaag 17
roosmakelaars.nlRoos MakelaarsRoos Makelaars is a real estate agency specializing in the sale, purchase, valuation, and rental of properties in Noordoost-Friesland and the Waddeneilanden (Wadden Islands).Property Sales → Buying a House 872 wadden islands 23 search request 53 real estate 4981 property 7406 Northeast-Friesland → Peazens 12
a7.nlA7 MakelaarsA7 Makelaars is a real estate brokerage firm offering various services related to housing.Property Valuation & Appraisal → Residential Appraisal 622 Property Advice & Guidance → Real Estate Advice 135 listings 525 assessment 1205 real estate 4981 house 8121 De Fryske Marren → Joure 689
puurapple.nlPuurApplePuurApple is a business that offers Apple repairs and refurbished Apple products.Repair → Mobile Phone Repair 1012 Computer Hardware & Peripherals → Computer Parts 26 macbook 174 refurbished 229 repair 14576 De Fryske Marren → Lemmer 1188
nutgaasterlan-sleat.nlNUT Gaasterlân-SleatThe website of NUT Gaasterlân-Sleat presents planned performances, the possibility to become a member, and to purchase tickets for cultural events.Institutions → Cultural Centers 610 ticket 2785 performance 7586 membership 10442 event 45199 De Fryske Marren → Balk 224
vastgoedboutique-unyk.nlVastgoedboutique UNYKVastgoedboutique UNYK is a personal real estate agent located in Sneek, Friesland, offering services for buying and selling property, including new construction, recreational homes and commercial spaces, as well as rental mediation and appraisals.Property Sales → Buying a House 872 Property Location & Neighborhood → Property 695 property listing 79 agent 1253 appraisal 1488 purchase 2212 sale 5930 property 7406 De Fryske Marren → Lemmer 1188
rijwielhandelboeklemmer.nlRijwielhandel BoekRijwielhandel Boek is a bicycle shop in Lemmer offering a wide range of bicycles, e-bikes, and accessories, as well as repair services and rentals.Bicycles → Two-Wheelers 238 Cycling → Bicycle Sales 455 bicycle shop 99 e-bike 908 bicycle 2838 insurance 6359 assortment 7799 workshop 19325 De Fryske Marren → Lemmer 1188
jezza.nlJezzaThe website Jezza is a gift shop located in Lemmer, Friesland, offering a wide variety of gifts, children's toys, and lifestyle products.Gifts → Children’s Gifts 67 candle 792 toy 2295 bag 2399 gift 6442 brand 17737 De Fryske Marren → Lemmer 1188
speelbosjoure.nlSpeelbos JoureSpeelbos Joure is a play location in Joure that offers various activities for children aged 1 to 12 years, including indoor play equipment, a laser game arena, and a kids escape room.Family Fun → Children’s Activities 1906 Family Fun → Family Activities 1493 laser game 142 escape room 430 playground 1088 wifi 1372 catering 6456 De Fryske Marren → Joure 689
deblaauwpleats.nlEetboerderij BlaauwpleatsThe website of Eetboerderij Blaauwpleats presents a restaurant and catering business located in the Fryske Marren, focusing on hospitality, events, and recreation in a historic farm environment.Hotels → Country Houses 172 Accommodation → Group Accommodation 844 boat rental 124 recreation 799 farm 2622 catering 6456 restaurant 11215 event 45199 De Fryske Marren → Sint Nicolaasga 146
jous.nlJOUS architectenJOUS architecten is an independent architecture firm specializing in the design and construction of various buildings, from private homes to complex architectural projects.Urban Planning → Urban Design 235 buildings 898 architecture 3223 construction 7421 design 27202 De Fryske Marren → Joure 689
wierdabedrijfswagens.nlWierda BedrijfswagensThe website of Wierda Bedrijfswagens presents the company as the MAN dealer for Friesland, with a long tradition (since 1931) and a comprehensive range of new and used MAN trucks and vans, including electric models and associated services.Financing → Leasing 1065 Freight & Logistics → Trucks 899 electric 269 man 453 truck 1412 vehicle 3743 maintenance 20093 Smallingerland → Drachten 2052
uitfestivalwvf.nlUIT FestivalThe website of UIT Festival describes the program of various festivals, including UIT Festival WVF and DFM, and provides information about the cultural activities taking place in the municipalities of Súdwest-Fryslân and De Fryske Marren.Festivals → Music Festivals 1020 Festivals → Regional Festivals 82 festival 3804 culture 3922 talent 3987 municipality 6837 event 45199 Friesland → Southwest-Friesland 4194
campingdeoosthoek.nlMini Camping De OosthoekThe website of Camping De Oosthoek presents a small, charming campsite in Friesland, located on water and near the Frisian lakes area, with the aim of informing visitors about the campsite and the possibilities it offers.Water → Lakes 232 Camping → Campsites Netherlands 792 toilet building 10 pitch 332 lake 352 harbor 691 campsite 2093 water 2501 De Fryske Marren → Lemmer 1188
yachts4u.nlYachts4UYachts4U offers boat rentals in Friesland, featuring a selection of motorboats and yachts.Water Sports → Sailing 1501 Marine & Watercraft → Yachts 189 motorboat 128 yacht 647 date 1112 holiday 2295 boat 2980 route 3425 Southwest-Friesland → Stavoren 155
lemsterdickensfestijn.nlStichting Lemster Dickens FestijnThe website of the Lemster Dickens Festival provides information about the event, including visitor information, events, volunteer opportunities, sponsorship packages, news, and photos.History → Historical Events 205 visitors 1048 atmosphere 5591 volunteer 8367 event 45199 De Fryske Marren → Lemmer 1188
statenenstinzen.nlStichting Staten en StinzenThe Stichting Staten en Stinzen is an organization focused on preserving and making accessible historical castles, country estates, and land estates in Friesland, particularly the states and stinzen from the Middle Ages.Cultural Attractions → Castles 178 country estate 25 state 44 route 3425 exhibition 5332 event 45199 De Fryske Marren → Joure 689
eetcafedefluessen.nlDe Fluessen Events BVEetcafé De Fluessen is a restaurant and cafe located in Elahuizen with a unique location on the De Fluessen canal, featuring a large harbor terrace and an orangery.Water Travel → Boat Tours 640 Food & Dining → Outdoor Seating 228 canal 507 gift certificate 646 harbor 691 cafe 1622 restaurant 11215 De Fryske Marren → Elahuizen 24
le50.nlStichting de LE 50The website of Stichting de LE 50 presents the history and restoration of the fishing vessel LE 50, a ship built in 1901, thereby showcasing a piece of local history.Accommodation → Pensions 46 Marine & Watercraft → Ships 132 restoration 3417 De Fryske Marren → Lemmer 1188
tschippershuis.nlHotel Restaurant ‘t Schippershuis”The website of Hotel Restaurant ‘t Schippershuis in Terherne showcases the hotel and restaurant, focusing on culinary experiences by the water, and the opportunity to book hotel rooms and reserve tables.Brasseries & Bistros → Brasserie 1005 meat 2055 water 2501 room 3411 hotel 3543 terrace 4847 restaurant 11215 De Fryske Marren → Terherne 98
herbergboswijck.nlHerberg BoswijckHerberg Boswijck is a B&B located in Gaasterland, Friesland, offering guests a stay in an area rich in nature and culture.Hiking → Trails 356 Accommodation → Guesthouses 726 living room 1325 breakfast 1822 room 3411 route 3425 environment 4873 restaurant 11215 De Fryske Marren → Balk 224
rondvaart-allure.nlRondvaart AllureThe website of Rondvaart Allure offers canal tours in and around Sneek and the Sneekermeer, primarily with the museum sloop 'de Venezuela'. The aim is to share the history and beauty of the region through these unique tours.Local History → City History 48 Water Recreation → Canal Tours 106 sneekermeer 14 canal tour 99 sloop 272 history 7286 De Fryske Marren → Goingarijp 86
detijnjehoeve.nlDe TijnjehoeveDe Tijnjehoeve is a charming, small camping and accommodation located in Friesland, offering glamping tents, a cottage, and a marina.Accommodation → Cabins 231 Nature → Nature Reserves 1032 glamping tent 18 group accommodation 260 cottage 299 marina 487 friesland 692 camp 2466 Southwest-Friesland → Sneek 1921
papagenohuisfryslan.nlStichting Papageno Huis FryslânPapageno Huis Fryslân is a developmental house that supports young adults and young adults with autism in their housing and career journeys, with a focus on independent living and daily activities.Venues & Rentals → Venues 2044 Institutions → Cultural Centers 610 church hall 23 daily activities 29 podium 74 cafe 1622 apartment 5088 volunteer 8367 De Fryske Marren → Lemmer 1188
vakantiehuisfriesemeren.nlVakantiehuis HenkThis website offers the opportunity to rent a holiday villa on the Frisian lakes in Friesland, with a focus on luxury and watersport activities.Houses → Luxury Accommodation 39 Accommodation → Bungalows 1008 holiday villa 40 pier 58 luxury 375 villa 1351 water 2501 garden 13129 Southwest-Friesland → Heeg 227
detsjukemar.nlStichting Kulturele Rûte TsjûkemarThe website presents an art route around the Tsjûkemar lake and organizes cultural events and activities in this area.Cycling → Cycling Routes 1002 Galleries & Exhibitions → Art Routes 215 art route 153 stichting 481 festival 3804 volunteer 8367 De Fryske Marren → Delfstrahuizen 47
heremaparklive.nlBSS SolutionsThe website of Herema Park Live provides information about the annual music festival held in Park Heremastate in Joure.Festivals → Music Festivals 1020 foodtrucks 182 park 1863 festival 3804 child 11566 music 13170 De Fryske Marren → Joure 689
defrijefries.nlMinicamping De Frije FriesMinicamping De Frije Fries is a small-scale campsite in Friesland that offers rest and nature to campers.Camping → Farm Camping 386 camping spot 26 tipi 68 sanitary 750 wifi 1372 nature 9094 De Fryske Marren → Delfstrahuizen 47
piacco.nlPiacco Café, Restaurant & PartycentrumPiacco Café, Restaurant & Partycentrum is a multifunctional center in Friesland offering a cafe, restaurant, party venue, and accommodation.Venues → Party Venues 363 Conferences & Meetings → Meeting Venues 729 party venue 18 meeting space 200 chalet 1264 buffet 1747 restaurant 11215 Southwest-Friesland → Hindeloopen 127
desimmerwille.nlSimmerwilleThe Simmerwille website offers boat tours on the Friesian Lakes, catering to both individual travelers and groups.Vacations → Water Travel 978 National Identity → Regional Culture 177 boat tours 22 lake 352 friesland 692 tours 1048 boat 2980
jousterklokkenmakerij.nlJouster KlokkenmakerijThe Jouster Klokkenmakerij website is a business specializing in the restoration, repair, and sale of clocks, with a focus on traditional Frisian clocks and antique clocks from various European origins.Repair → Watch Repair 73 Crafts → Clockmaking 51 clockmaker 24 clocks 178 restoration 3417 De Fryske Marren → Joure 689
de-koaipleats.nlKleefstra FamilyThe website of Camping De Koaipleats presents a farm camp in Terherne, located in the water-rich area of Terhorne, offering the opportunity to camp, rent a luxury chalet, and participate in activities in the region.Accommodation → Bungalow Parks 931 Nature → National Parks 898 marina 487 farmhouse 878 chalet 1264 campsite 2093 Heerenveen → Akkrum 246
mijnzusenikbootcamp.nlMijn Zus & Ik Bootcamp LemmerThe website of Mijn Zus & Ik Bootcamp Lemmer offers outdoor bootcamp training sessions catering to various groups, including individuals, companies, and families, with personalized coaching and guidance from certified trainers.Group Class → Bootcamp 208 bootcamp 497 friesland 692 trainer 1966 beach 3210 De Fryske Marren → Lemmer 1188
mirnserheide.nlCamping MirnserheideThe Camperplaats Mirnserheide website presents a camper site located in Friesland, near the IJsselmeer and Rijsterbos, suitable for short and longer stays, emphasizing a welcoming environment and proximity to nature and cities.Camping → Camper Sites 243 Parks & Gardens → Parks 1043 nature reserves 23 kitesurfing 98 camper site 126 friesland 692 De Fryske Marren → Rijs 32
nofliknijemirdum.nlNoflik NijemirdumThe website of Noflik Nijemirdum presents a comfortable apartment in Friesland, located in a nature-rich environment, suitable for those seeking peace and quiet, nature lovers and holidaymakers who want to enjoy the Frisian nature and activities such as hiking, cycling and kitesurfing.Apartment Living → Luxury Apartments 304 Nature → Nature Lodges 32 friesland 692 view 1045 holiday 2295 apartment 5088 nature 9094 Southwest-Friesland → Workum 363
lemsterwike.nlSHPLThe website Lemsterwike presents the program for the annual festival Lemsterwike, a party that takes place in Lemmer and surrounding areas from August 4th to 9th.Festivals → Regional Festivals 82 djs 199 sponsors 2642 festival 3804 De Fryske Marren → Lemmer 1188
bizlemmer.nlBIZ LemmerThe BIZ Lemmer website provides information about the business investment zone and offers opportunities for donation and engagement.Business Strategy → Business Development 730 Social Organization → Senior Organizations 750 biz 52 post 140 donor 757 board 3438 agenda 4374 De Fryske Marren → Lemmer 1188
fotografiebywilma.nlFotografie By WilmaThe website Fotografie By Wilma offers professional photography services, specializing in family photos, dog photography, iris photography, and attendance at local events in Friesland. The site provides an overview of photoshoot days and the opportunity to book special offers.Family & Newborn → Individual Photography 98 iris 29 photoshoot 1018 dog 5483 family 6462 photography 9503 event 45199 De Fryske Marren → Balk 224
kampeerboerderijhettinga.nlKampeerboerderij HettingaKampeerboerderij Hettinga is a camping farm located on the Friesian Lakes offering guests a peaceful and spacious camping experience.Camping → Farm Camping 386 farm animals 28 lake 352 watersport 540 camp 2466 facility 2616
joure80.nlMunicipality of JoureThe website provides information about an event commemorating the liberation of Joure, taking place on April 27, 2024, at the ‘De Oerdracht’ building in Joure.Neighborhood Organizations → Residents’ Associations 965 History → Historical Events 205 liberation 116 tank 250 bridge 557 film 3007 concert 4409 event 45199 Southwest-Friesland → Sneek 1921
greatt.nlGre@ttThe website ‘Gre@tt Tassen van Leer’ is an online shop selling leather bags, wallets, and accessories, with a focus on handbags and keychains made of genuine leather.Accessories → Bags 1001 Accessories → Leather Accessories 13 keychain 172 leather 785 pattern 2012 message 2260 bag 2399 color 4159 De Fryske Marren → Boornzwaag 17
hethuisaandefluessen.nlIt Blin EzelThe ‘It Blin Ezel’ holiday house, located on the Fluessen in Elahuizen, Friesland, serves as a base for vacations in the area of lakes and forests.Accommodation → Cottages 298 Nature → Forest 387 lake 352 holiday house 402 forest 1418 house 8121 nature 9094 De Fryske Marren → Balk 224
oranjebloem.nlOranjebloem Coaching and ExperienceThe website of Oranjebloem Coaching and Experience offers information about various activities, including organizational consulting, coaching, and yoga classes, with a focus on personal growth, resilience, and sustainable solutions.Office & Workspace → Operations 219 quality management 169 yoga 3704 coach 25810 De Fryske Marren → Lemmer 1188
vakantiehuis-rijsterbos-friesland.nlVakantiehuisje RijsterbosThe website offers holiday homes for rent in Friesland, specifically in Rijs, in a traditional Friesian stelpboerderij near the Rijsterbos.Landscape → Regional Landscapes 18 Accommodation → Holiday Parks 1024 friesland 692 holiday home 2753 house 8121 De Fryske Marren → Rijs 32
abos.nlABOSThe website of ABOS offers services and solutions for maintaining the safety of play equipment for children, young people, and adults.Technical Services → Maintenance Companies 517 Outdoor → Play Equipment 313 play equipment 173 inspection 4279 safety 5819 maintenance 20093 De Fryske Marren → Lemmer 1188
agricolabouw.nlAgricola Bouw B.V.Agricola Bouw B.V. is a construction company specializing in various building projects and developments, primarily in Friesland, Netherlands.Construction Companies → Residential Construction 1013 Construction Companies → Regional Construction Companies 152 construction project 701 farmhouse 878 renovation 13849 De Fryske Marren → Lemmer 1188
rondvaartbedrijf-harmonie.nlParty- and Roundboat Company HarmonieParty- and Roundboat Company Harmonie is a company that organizes round trips and tours on the Friesian lakes.Conferences & Meetings → Corporate Events 2472 Water Sports → Water Recreation 599 roundboat 13 day trip 257 boat 2980 arrangement 3104 catering 6456 event 45199 Southwest-Friesland → Workum 363
femaanhetdok.nlFEM aan het DokFEM aan het Dok is a restaurant in Lemmer that offers breakfast, lunch, dinner, catering, and Christmas menus.European → Dutch 48 Brasseries & Bistros → Bistro 594 christmas menu 28 dinner 1533 breakfast 1822 dish 5936 catering 6456 restaurant 11215 De Fryske Marren → Lemmer 1188
lopifitgaasterland.nlLopifit GaasterlandLopifit Gaasterland offers a unique way to explore the landscape of Gaasterland, allowing visitors to walk while riding a special bike.Landscape → Dutch Landscapes 41 Cycling → Bicycle Rental 643 bike 1541 route 3425 Weststellingwerf → Wolvega 524
restaurantrosemary.nlRosemaryThe Rosemary website is for a restaurant in Friesland, Netherlands, specializing in high-quality, fresh, and locally sourced food, offering a relaxed fine dining experience for lunch, drinks, and dinner.Fine Dining & Gastronomy → Dining 677 reservation 3373 food 3872 newsletter 6504 restaurant 11215 event 45199 De Fryske Marren → Joure 689
taxibosman.nlTaxi BosmanThe Taxi Bosman website offers a variety of personal and business transport services, including airport transfers, school transportation, and bus rentals, with a particular focus on 24-hour service and mobility for groups.Transportation Services → Passenger Transport 653 Bus Services → Public Transportation 782 bus rental 10 taxi 2090 transport 6105 De Fryske Marren → Rijs 32
outdoor-oudehaske.nlOutdoor OudehaskeOutdoor Oudehaske is a recreational facility located in Oudehaske offering various activities such as footgolf, klompengolf, laser games and the Alleskunner for family outings, corporate events, and children’s parties.Family Gatherings → Family Days 14 Events & Activities → Outdoor Activities 1043 footgolf 22 family outing 25 laser game 142 corporate outing 388 De Fryske Marren → Joure 689
studiooak.nlStudio OAKThe Studio OAK website showcases interior concepts designed by the company for commercial purposes, primarily for offices, hospitality, and retail, aiming to strengthen the client’s brand identity and create unique spaces.Creative & Design Services → Design Agencies 457 inspiration book 21 space 3846 interior 8093 brand 17737 De Fryske Marren → Langweer 93
kleuropkleur.nlKleur op Kleur InterieurKleur op Kleur Interieur is an interior design consultancy located in Friesland that assists consumers and businesses in creating stylish and atmospheric interiors.Interior Design → Interior Styling 676 Interior Design → Interior Consulting 615 color 4159 studio 5465 interior 8093 De Fryske Marren → Terherne 98
huisje-aan-het-water.nlEuroparcsThe website offers an overview of houses by the water in the Netherlands, allowing users to rent them, including options with boats, sloops, fishing docks, and other amenities.House Types → Houses 2546 pier 58 holiday park 566 water 2501 boat 2980 house 8121 Elburg → Dronten 110
molendekaai.nlStad Sloten en zijn molenThe website provides information about Korenmolen de Kaai in Sloten, including its history, current status, opening hours and products.Historical Sites → Mills 229 Bakery & Food Production → Milling 34 mill 487 view 1045 history 7286 Amsterdam → Sloten 146
onderdeboog.nlOnder de BoogOnder de Boog is a foodbar located in Joure offering various options for lunch, drinks, high tea and parties.Cafes & Lunch → Lunchroom 446 Nutrition → Healthy Eating 634 play area 173 pastries 946 breakfast 1822 atmosphere 5591 party 5928 dish 5936 De Fryske Marren → Joure 689
broekens.nlBroekens BVThe website of Broekens BV is an online platform that showcases the activities of a farm machinery business in Friesland, providing information on locations, machinery, used equipment, and contact options.Machinery & Repair → Mechanization 60 Logistics & Transport → Agricultural Retail 113 used equipment 22 machinery 519 agriculture 778 tractor 789 De Fryske Marren → Elahuizen 24
tweespan-lemmer.nlTweespan schoolThe website of the Tweespan school in Lemmer informs interested parties about the school and the development of the children.Primary Education → Montessori Education 167 Primary & Secondary Schooling → School-Related 44 school guide 150 parent 4318 school 7856 child 11566 De Fryske Marren → Lemmer 1188
obsdemeerpaal-lemmer.nlOBS De MeerpaalThis website provides information about OBS De Meerpaal school to parents, students, and visitors.Elementary Schools → Public Elementary Schools 406 Neighborhood Focus → Neighborhoods 1028 policy 2149 parent 4318 student 7623 school 7856 De Fryske Marren → Lemmer 1188
ehboweb.nlEHBOWEBThe website provides an overview of EHBO (First Aid) organizations in the Netherlands.Prevention → First Aid 1070 Government & Administration → Government Organizations 1002 ehbo 158 postcode 221 overview 329 knowledge base 569 training 28133 Waadhoeke → Oudebildtzijl 26
schilderterherne.nlVan der Meer SchildersThe website of Schilder in Terherne presents a family business with a long tradition (since 1880) specializing in various painting and decorating services, including interior and exterior painting, wood imitation, decorative ship painting, and repairs.Pastry → Cakes 826 Building & Materials → Paint 923 wood imitation 11 decorate 48 shop 6483 paint 8747 repair 14576 De Fryske Marren → Terherne 98
grasbanen.nlGrasbanen.nlGrasbanen.nl is a website providing information and a schedule for harness racing meetings on grass in various locations in the Netherlands.Equestrian → Harness Racing 29 race 1043 meeting 2381 schedule 2624 horse 4337 competition 4759 Noordoostpolder → Emmeloord 1649
saunadebongerd.nlSauna de BongerdSauna de Bongerd is a sauna and wellness facility located in West Friesland, Netherlands, offering sauna experiences, recreation, and well-being.Spa → Saunas 920 sauna 1175 wellness 1561 yoga 3704 relaxation 3968 nature 9094 De Fryske Marren → Lemmer 1188
marlieskruijer.nlMarlies KruijerThe website of Marlies Kruijer presents her books and blogs.Novel → Historical Novel 24 Literature → Authors 409 west-friesland 41 novel 440 castle 494 publisher 757 book 11396 blog 13392 De Fryske Marren → Lemmer 1188
voervoorpaarden.nlFeed For HorsesThe website ‘Feed For Horses’ is an online store specializing in the sale of horse feed and supplements, with a focus on a wide assortment of top brands and offering benefits such as free shipping and delivery.Animal Feed → Horse Feed 52 horse feed 83 delivery service 236 supplement 1968 ship 5103 brand 17737 De Fryske Marren → Echten 54
pizzerialagondola.nlRistorante Pizzeria La GondolaThe website of Pizzeria La Gondola is an online presentation of a family-run restaurant serving pizzas, pasta, meat, and fish, with a focus on freshly prepared dishes and a restaurant with a terrace by the water.Food Delivery → Italian Restaurant 1040 Food & Dining → Outdoor Seating 228 specials 65 family business 793 reservation 3373 pizza 4158 restaurant 11215 De Fryske Marren → Lemmer 1188
happinessconcept.nlRainbow JoureRainbow Joure is a location offering a wide range of activities and services for adults and children, with a focus on fun, relaxation, and quality time.Brasseries & Bistros → Bistro 594 Sport Facility → Sports Centers 439 foodbar 21 kids 84 childcare 3512 sport 4228 treatment 21203 De Fryske Marren → Joure 689
minicamping-weideland.nlMinicamping WeidelandMinicamping Weideland is a cozy campsite in Weststellingwerf, Friesland, offering visitors the opportunity to enjoy peace, space, and nature, with access to diverse natural areas and activities in the surrounding area.Camping → Minicamping 246 recreation lake 20 natural area 208 campsite 2093 accommodation 4921 shop 6483 event 45199 Weststellingwerf → Steggerda 21
chrisveldhof.nlChris VeldhofThe website of Chris Veldhof showcases his work as an artist, specializing in murals, 3D art trees, and paintings. It offers services for businesses and individuals and organizes workshops.Workshops → Art Workshops 119 Painting → Murals 125 mural 338 paintings 3907 workshop 19325 Tubbergen → Fleringen 40
ocodenktmee.nlOCOThe OCO website provides independent client support to residents of various regions in Friesland, focusing on offering assistance with life questions and helping to find suitable solutions.Social Services → Client Support 59 Social Issues & Welfare → Rights 384 client support 42 judgment 66 question 2261 region 5412 Friesland → Weststellingwerf 829
ccrlemmer.nlCCR LemmerCCR Lemmer is an official Laika dealer that sells campers, caravans, and accessories, along with service and maintenance.Recreational Vehicles → Camper 464 Construction & Maintenance → Service Companies 86 caravan 1394 camper 1596 accessories 12975 maintenance 20093 De Fryske Marren → Lemmer 1188
orthoemmeloord.nlOrthodontists Practice SchoonderbeekOrthodontists at Orthodontists Practice Schoonderbeek Emmeloord offer orthodontic treatments for a radiant smile and straight teeth.Dentistry → Orthodontics 469 Dentistry → Teeth Whitening 146 brace 376 smile 514 patient 4082 competition 4759 De Fryske Marren → Lemmer 1188
vriendenvanmuseumjoure.nlFriends of Museum JoureThe website of Friends of Museum Joure aims to encourage visitors to support the museum by becoming a member or making a donation, enabling important activities such as exhibitions and restoration work.Politics → Activism 237 Museums → Dutch Museums 28 benefits 369 museum 2002 donation 5110 exhibition 5332 association 8562 membership 10442 De Fryske Marren → Joure 689
praktijksandramous.nlPraktijk Sandra MousThe website of Sandra Mous is an orthomolecular therapy practice focused on diagnosing and treating complaints in women, particularly regarding fertility and improving health through orthomolecular nutrition.Alternative Medicine → Orthomolecular Medicine 340 Health → Pharmaceuticals & Medical Products 2409 nutrition 4935 complaint 6479 research 8967 De Fryske Marren → Balk 224
zwinzicht.nlFam. Meine and Maaike van Dijk ZwinzichtThe website of Minicamping Zwinzicht presents a family campsite in Friesland, located in Harich, focusing on peace, space, and enjoying nature.Campsites → Family Campgrounds 15 Camping → Farm Camping 386 cabin 351 nature area 497 chalet 1264 forest 1418 campsite 2093 Southwest-Friesland → It Heidenskip 35
marcohaakman.nlMarco HaakmanThe website of Marco Haakman showcases handcrafted wooden kitchens, kitchen renovations, outdoor houses and interiors, primarily in West Friesland.Garden → Garden Houses 355 woodwork 387 veranda 1055 kitchen 6443 interior 8093 design 27202 De Fryske Marren → Lemmer 1188
hinkehuisman.nlHinke HuismanThe Atelier Hinke Huisman offers creative courses, workshops, and coaching aimed at discovering and developing the creative potential of visitors.Arts & Culture → Arts Education 323 atelier 1417 creativity 2531 inspiration 4081 course 14728 workshop 19325 coach 25810 De Fryske Marren → Lemmer 1188
taartvoorkids.nlStichting Taart Voor KidsTaart voor Kids is a foundation dedicated to providing children associated with food banks with a memorable birthday.Social Organization → Child Welfare 1147 Social Organization → Children’s Organizations 467 food bank 216 birthday 252 sponsor 1159 cake 1730 donation 5110 De Fryske Marren → Lemmer 1188
luxewagen.nlLuxewagenLuxewagen is a car dealer specializing in premium used cars and offers leasing and financing options.Cars → Luxury Cars 107 Leasing → Auto Leasing 565 lease 1595 history 7286 price 8328 car 10865 De Fryske Marren → Joure 689
debruinencho.nlDe Bruin & ChoDe Bruin & Cho is a salon offering hair, spa, and lifestyle services in Lemmer and Joure.Dermatology → Scalp Care 402 Hair Salons → Hair Services 112 hair 3014 salon 5541 treatment 21203 De Fryske Marren → Lemmer 1188
fietsverhuurlemmer.nlBike Totaal Rodenburg LemmerThe website of Bike Totaal Rodenburg Lemmer is an online platform for bicycle rental in Lemmer and surrounding areas, primarily offering the rental of city bikes and electric bikes from the Gazelle brand.Cycling → Bicycle Rental 643 gazelle 34 bicycle shop 99 bicycle 2838 rental 7257 De Fryske Marren → Lemmer 1188
lesalonhairstyling.nlLe Salon HairstylingLe Salon Hairstyling is a hair salon in Joure that offers customers a haircut and a positive experience.Men’s Issues → Men’s Fashion 154 haircut 1158 trend 1865 hair 3014 appointment 13510 De Fryske Marren → Joure 689
bossclassics.nlBoss ClassicsBoss Classics is a company specializing in Mini's, Mini motorcycles, and the repair and maintenance of various vehicles, with a focus on occasions and classic Mini's.Repair → Garage 1779 Automotive Maintenance → Workshops 307 mini 101 apk 1333 tire 1975 occasion 2036 repair 14576 workshop 19325 De Fryske Marren →  Sintjohannesga 24
tim-tom.nltim tomTim Tom is a vintage concept store offering an exclusive collection of vintage furniture and design objects.Lighting → Vintage Furniture 209 Living & Dining → Chairs 393 armchair 201 desk 394 De Fryske Marren → Lemmer 1188
autoschaap.nlAuto SchaapAuto Schaap is a Saab and Volvo dealer and specialist in Friesland and Flevoland, offering service and maintenance for these brands.Brand → Volvo 157 Car Dealerships → Brand Dealer 156 saab 65 volvo 205 used cars 894 workshop 19325 maintenance 20093 De Fryske Marren → Lemmer 1188
dudocxp.nlConstruction & Technical CampusThe DudocXP website describes a collaborative project focused on training adequately qualified professionals for the construction and technical sector in the regions of North Kennemerland and West Friesland.Vocational Training → Vocation 69 Marine & Shipping → Maritime 1022 campus 148 partnership 1407 region 5412 construction 7421 training 28133 De Fryske Marren → Lemmer 1188
liefsvansiets.nlLiefs van Siets FotografieThe website of Liefs van Siets Fotografie offers professional wedding and bridal photography, focusing on capturing emotional moments and details.Services → Personal Services 1062 TravelStyles → Wedding Travel 25 ceremony 824 moment 1034 emotion 2169 wedding 4258 photography 9503 De Fryske Marren → Echten 54
reefhorst.nlDe ReefhorstDe Reefhorst is an official Jaguar and Land Rover dealer.Cars (Brands) → Jaguar 23 jaguar 43 land rover 91 dealer 757 address 901 professionals 1966 De Fryske Marren → Oudehaske 49
vtm-machines.nlVTM MachinesThe website of VTM Machines offers a wide range of machines and attachments for agriculture, the green sector, industry, and construction, and operates as an importer and wholesaler.Machinery & Repair → Machinery 1045 bucket 113 attachment 208 manufacturer 355 machine 3727 assortment 7799 De Fryske Marren → Joure 689
mooiimoment-fotografie.nlMooii MomentMooii Moment is a photographer specializing in wedding photography and various other portrait photography services.Visual Communication → Personal Branding 70 Imaging & Photography → Family & Newborn 1285 maternity 226 wedding 4258 child 11566 De Fryske Marren → Lemmer 1188
websitebereikt.nlWebsitebereiktWebsitebereikt.nl is a web design agency located in Joure, Friesland, specializing in creating bespoke websites and providing maintenance services with the goal of reaching the target audience and delivering results for clients.Web Design & Development → Digital Marketing 998 results 3954 webdesign 4092 marketing 7107 De Fryske Marren → Joure 689
loopjeloopje.nlLoopjeloopjeThe website Loopjeloopje.nl offers a hard running calendar specifically for the northern provinces and related events.Football → Competitions 1072 Local & Regional → Regional Events 821 search field 15 distance 270 race 1043 date 1112 calendar 1556 Leeuwarden → Stiens 263
sharpfocus.nlNienke Wuring Creative PhotographerThe website of Fotograaf Enkhuizen offers a range of photography services, including portraits, wedding and family photography, catering to both private and business clients.Imaging & Photography → Family & Newborn 1285 family photo 79 wedding photography 172 canvas 694 photoshoot 1018 portrait 3685 photography 9503 Noordoostpolder → Emmeloord 1649
graafland.nlGraaflandThe website offers a wide range of products and materials for building and furnishing greenhouses, greenhouses and overkappingen (overhangs), with a focus on both hobby gardeners and professional cultivation.Garden Structures → Greenhouses 166 overhang 185 greenhouse 740 heat 2188 accessories 12975 Vleuten - De Meern → Vleuten 574
dok20lemmer.nlGastenverblijf Dok 20Gastenverblijf Dok 20 is a guest house in Lemmer, Netherlands, offering views of the historic city center and canal.Accommodation → Guesthouses 726 view 1045 accommodation 4921 De Fryske Marren → Lemmer 1188
grootnieuweboer.nlGroot & Nieuweboer MakelaardijGroot & Nieuweboer Makelaardij is a real estate agency operating in West Friesland, offering services related to buying, selling, appraising, and renting property.Real Estate → Property Search & Listings 506 Context 161394 seeker 30 listings 525 valuation 2697 rental 7257 property 7406 house 8121 Medemblik → Wervershoof 226
alrako.nlAlrako BVAlrako is a company that provides advice and services regarding aluminum and plastic projects.Wood & Timber → Timberwork 1596 Windows & Doors → Windows 2999 aluminum 1197 plastic 1232 window 2030 door 2210 De Fryske Marren → Balk 224
friesemerenvillas.nlFriese Meren Villa'sThe website of Friese Meren Villa's offers luxury water villas and lodges for rent in Friesland, focusing on vacations at the Friesian Lakes, primarily at the Tjeukemeer and in Delfstrahuizen.Accommodation → Villas 1018 Water → Lakes 232 tjeukemeer 11 lodge 340 watersport 540 villa 1351 wellness 1561 De Fryske Marren → Delfstrahuizen 47
tuincentrum-dekoning.nlTuincentrum De KoningTuincentrum De Koning is a garden center located in Rohel, Friesland, offering a wide range of garden plants, houseplants, home accessories, and supplies.Gifts & Occasions → Flower Shops 776 Outdoor & Garden → Garden Shops 795 garden plants 66 houseplant 111 home accessories 603 balcony 846 plant 4509 Friesland → Heerenveen 2578
slachtpaspoort.nlHet SlachtpaspoortThe website ‘Slachtpaspoort’ presents a book filled with photos, stories, and recipes about slaughtering animals collected by Daniel Gravemaker.Culture → Literature 3578 Essential → Food 47999 animal 2908 recipe 5142 book 11396 Schouwen-Duiveland → Bruinisse 214
eetcafehetfar.nlEetcafé 't FarThe website of Eetcafé 't Far describes a restaurant in Terherne that focuses on honest, pure, and attentive food and drink in a pleasant setting, with a historical background of the village of Terherne.Outdoor → Terraces 188 Agricultural Tourism → Agricultural Recreation 105 ice 178 beer 2887 food 3872 atmosphere 5591 history 7286 Heerenveen → Akkrum 246
middelbosjoure.nlMiddelbos JoureThe website of Middelbos Joure is a service-oriented website specializing in the repair, maintenance, and sale of construction machinery and mobile air conditioning systems.Technical Services → Technical 957 Agriculture → Agricultural Machinery & Equipment 631 machinery 519 air conditioning 2178 inspection 4279 sale 5930 repair 14576 maintenance 20093 De Fryske Marren → Joure 689
geartsje-webwinkel.nlGeartsje-WebwinkelThe website 'Geartsje-Webwinkel' is a home and online shop selling charming vintage and new home decor items in a rustic French-Scandinavian style, sourced from France, Belgium, and the Netherlands.Antiques & Collectibles → Vintage 623 Antiques & Collectibles → Brocante 177 home decor 400 vintage 689 shop 6483 collection 7566 webshop 8648 furniture 8751 De Fryske Marren → Echtenerbrug 24
kmktrainingen.nlKMK TrainingenThe KMK Trainingen website offers training and coaching programs focused on personal development, communication, and Neuro-Linguistic Programming (NLP), targeting individuals and teams.Business Strategy → Business Development 730 Management → Team Coaching 464 nlp 487 personal development 810 communication 10162 collaboration 16036 coach 25810 training 28133 De Fryske Marren → Echten 54
zijlstrabetontechniek.nlZijlstra BetontechniekThe website of Zijlstra Betontechniek presents services in the field of concrete repair and related specialist works.Building Science & Analysis → Moisture Control 144 plastic flooring 19 concrete repair 59 injection 111 grinding 120 De Fryske Marren → Joure 689
dewittebv.nlDe Witte BVThe website of De Witte BV from Staphorst presents its services in the field of new construction, renovation, and restoration, with a focus on houses, commercial buildings, and care facilities.Construction Companies → Residential Construction 1013 care facility 74 commercial building 127 school 7856 house 8121 renovation 13849 Westerveld → Havelte 228
dutchfishingexperience.nlDutch Fishing ExperienceThe website provides fishing guide services and booking arrangements for sport and pike fishing in the Netherlands.Water Activity → Fishing 1055 fishing guide 17 motor 614 boat 2980 arrangement 3104 De Fryske Marren → Delfstrahuizen 47
uitvaartverzorging-ehbc.nlUitvaartverzorging EHBCUitvaartverzorging EHBC provides funeral services and related services in the Hoorn region and surrounding areas.Funeral Services → Funeral Arrangement 486 Legal → Inheritance Law 545 funeral service 127 inheritance 354 funeral 2477 wishes 2717 De Fryske Marren → Lemmer 1188
valkeringtweewielers.nlValkering TweewielersValkering Tweewielers is a bicycle shop specializing in Gazelle bikes, located in the Kop van Noord-Holland, offering a wide assortment and advice.Bicycles → Electric Bicycles 402 gazelle 34 bike 1541 bicycle 2838 showroom 4883 assortment 7799 De Fryske Marren → Lemmer 1188
a7campers.nlA7CampersThe website A7Campers.nl is an online platform and showroom specializing in the sale and brokerage of used and second-hand campers, with a focus on luxurious and well-maintained vehicles.Automotive → Sales 1205 Road Services → Automotive 18764 trade-in 254 camper 1596 showroom 4883 finance 5341 sale 5930 De Fryske Marren → Sint Nicolaasga 146
premiumglass.nlPremium GlassThe website of Premium Glass presents their range of exclusive glass products and glass, steel, and wood solutions.Building & Materials → Glass 697 steel 1177 glass 2919 wood 4153 De Fryske Marren → Joure 689
vvvjoure.nlVVV JoureVVV Joure is a tourist information and planning service for trips to Joure and other destinations.Accommodation → Holiday Parks 1024 Vacations → Regional Vacations 28 park 1863 tips 2789 vacation 4234 blog 13392 De Fryske Marren → Joure 689
walingatrikes.nlWalinga TrikesWalinga Trikes is a company that sells, rents, and maintains trikes, with a focus on experience and service in Friesland and beyond.Motorcycles → Scooters 903 trike 29 occasion 2036 model 3546 showroom 4883 rental 7257 maintenance 20093 De Fryske Marren → Lemmer 1188
pnslagter.nlFirma P.N. SlagterThis website of Firma P.N. Slagter presents a company specializing in the cultivation and trade of cauliflower, primarily in the West-Friesland region.Horticulture & Floristry → Crops 96 Supply Chain & Logistics → Trade 2141 cauliflower 10 europe 289 supermarket 406 cultivation 481 trade 553 De Fryske Marren → Lemmer 1188
part-ner.nlPart-NerPart-Ner is a private nature management company that offers certification services.Agricultural Technology & Innovation → Sustainable Agriculture 278 Consulting → Environmental Consulting 555 nature management 81 land 472 certification 3380 De Fryske Marren → Elahuizen 24
natuurlijkbijpuur.nlNatuurlijk bij PUURNatuurlijk bij PUUR is a webshop and salon that focuses on selling organic and natural skincare products.Cosmetics & Skincare → Cosmetics 1122 Fashion → Fragrances 598 relaxation 3968 salon 5541 treatment 21203 De Fryske Marren → Joure 689
brdgadvies.nlBRDG AdviesBRDG Advies is a consultancy firm specializing in spatial-economic issues and advising various government and business entities.Local Economy & Development → Regional Development 296 Community → Government & Administration 10567 province 518 municipality 6837 research 8967 Oldambt → Winschoten 830
vdwerfbakhuizen.nlVan der Werf Transport BV / De firma F. Van der Werf en Zn.The website of vd Werf Bakhuizen is an online platform for a transport company that has been active in Bakhuizen since 1913. The company offers transport services and presents its history and specializations.Logistics & Transport → Logistics 7444 Road Services → Road Transport 400 scania 19 barrel 69 milk 421 transport 6105 quote 12863 De Fryske Marren → Bakhuizen 45
gebloemt.nlGebloemtGebloemt is a flower shop with an online store offering a wide range of flowers and floral arrangements, including specialized services such as wedding flowers and funeral flowers.Gifts & Occasions → Flower Shops 776 Outdoor & Garden → Garden Shops 795 wedding flowers 81 funeral flowers 199 floral arrangement 344 online store 905 flowers 3248 De Fryske Marren → Lemmer 1188
jagtax-trouwautos.nlJagtax Trouwauto verhuurJagtax Trouwauto verhuur is a company that rents classic and modern Jaguar cars for special occasions, primarily weddings.Rental Services → Car Rental 1047 friesland 692 idea 2367 model 3546 wedding 4258 rental 7257 car 10865 De Fryske Marren → Joure 689
warenhuis-jdeboer.nlWarenhuis and Houthandel J. de BoerWarenhuis and Houthandel J. de Boer is a shop that sells wood, do-it-yourself items, and gift items.Wood → Timber Merchant 62 Retail & Commerce → Retailers 754 decoration 4085 wood 4153 gift 6442 construction 7421 garden 13129 De Fryske Marren → Delfstrahuizen 47
lemsterwolhus.nlHet LemsterwolhusHet Lemsterwolhus is a wool shop in Lemmer, Friesland, that sells a wide range of knitting, crochet, and sewing supplies, including yarn and patterns.Crafts → Knitting 537 Crafts → Crochet 378 needle 166 yarn 407 wool 489 pattern 2012 De Fryske Marren → Lemmer 1188
flyerprint.nlFlyer PrintFlyer Print is a printing company located in Joure that offers a variety of printing services, including design, offset printing, digital printing, and direct mail.Printing & Production → Printing 690 Printing & Production → Print Media 207 direct mail 75 press 147 print 5511 design 27202 De Fryske Marren → Balk 224
vanhoornzeggen.nlStichting Streekomroep West-FrieslandThis website details the collaboration between local radio stations in West-Friesland to create a more robust regional broadcasting service.Entertainment → Radio 1338 News & Journalism → Local Media 208 west-friesland 41 stichting 481 programming 575 radio 1200 board 3438 collaboration 16036 De Fryske Marren → Lemmer 1188
takelbedrijfhof.nlTakelbedrijf HofTakelbedrijf Hof is a recovery service based in Heerenveen that specializes in the safe recovery of vehicles following accidents or breakdowns, both nationally and internationally.Road Services → Road Transport 400 breakdown 22 recovery 868 address 901 vehicle 3743 transport 6105 insurance 6359 Heerenveen → Akkrum 246
talenthoorn.nlStichting TalentThe website of Stichting Talent presents an organization offering basic education and childcare in the municipalities of Hoorn, Blokker, and Zwaag, and provides information about working for the foundation.Childcare → Daycare Centers 987 childcare center 140 childcare 3512 partner 4272 vacancy 6598 education 13471 De Fryske Marren → Lemmer 1188
infocentrumbinnenwateren.nlInfo Centrum BinnenwatererenThis website provides information about well-known and lesser-known inland waters in the Netherlands, aiming to inform visitors about sailing and boating opportunities and the appeal of these locations.Water → Boating 1592 sail 965 water 2501 boat 2980 blog 13392 De Fryske Marren → Delfstrahuizen 47
rblemmer.nlReddingsbrigade LemmerThe website of Reddingsbrigade Lemmer presents information about the association, its activities and courses, and invites visitors to participate.Swimming → Rescue Squads 16 Swimming → Swimming Clubs 242 diploma 795 swimming 850 course 14728 event 45199 De Fryske Marren → Lemmer 1188
nutjoure.nlNutJoureThe website of NutJoure presents the history, activities, programs and board of directors of the association, which was founded in 1822 to serve the community in Joure.Associations → Village Associations 152 Local Government → Municipal Organizations 416 performance 7586 membership 10442 event 45199 De Fryske Marren → Joure 689
zonvooriedereen.nlZonVoorIedereenZon for Everyone is an organization dedicated to the realization of local energy projects with a focus on 100% local ownership and social goals.Cooperatives → Energy Cooperatives 315 energy cooperatives 27 ownership 82 municipality 6837 energy 9075 De Fryske Marren → Balk 224
hetzwembad.nlStichting Zwembad MidwoudThe Zwembad Midwoud is a swimming pool that offers activities, lessons and subscriptions to visitors in West Friesland.Garden → Swimming Pools 601 lesson card 20 swimming pool 1664 sponsors 2642 subscription 3287 volunteer 8367 De Fryske Marren → Lemmer 1188
visservice.nlVisserviceVisservice is a company that organizes fully catered fishing trips to Norway.Events → Business Travel 249 SpecificDestinations → Exotic Travel 50 fishing guide 17 fishing trip 20 norway 97 fish 1121 destination 2580 vacation 4234 De Fryske Marren → Joure 689
kynoservice.nlKynoServiceThe KynoService website is an online platform providing information about a dog school located in the Emmeloord, Lemmer, Noordoostpolder and Friesland regions. The purpose is to inform potential customers about the various training options and services offered.Dogs → Dog Training 881 dog school 114 behavior therapy 125 ideal 249 course 14728 training 28133 De Fryske Marren → Lemmer 1188
a6.nlA6 Carservice BVA6 Carservice BV is an auto dealership located in Lemmer specializing in the sale of new, high-quality used cars. The company offers a wide selection of vehicles, financing options, and a delivery package with technical inspection and mileage report.Cars → Lease Cars 72 Automotive → Financing 1569 lease 1595 inventory 1613 showroom 4883 finance 5341 car 10865 De Fryske Marren → Lemmer 1188
doopsgezindjoure.nlDoopsgezinde Kerk JoureThe website of the Doopsgezinde Kerk Joure provides information about the church, its activities, services, the 2024 jubilee, the possibility of renting the church building, and the senior pastor Theo de Jong.Protestantism → Mennonite 23 Protestantism → Churches 1009 pastor 208 jubilee 244 church 3439 rental 7257 De Fryske Marren → Balk 224
ogmf.nlOGMFThe website of OGMF (Onderwijsgroep Midden-Friesland) provides information about the collaborative educational organizations OSG Sevenwolden, Bornego College and Bornego Junior College. The aim is to inform prospective students, parents and other stakeholders about the schools and their offerings.Primary Education → School Districts 27 Primary & Secondary Schooling → Secondary Education 1639 board 3438 registration 4366 school 7856 education 13471 De Fryske Marren → Joure 689
hetkompas-meilan.nlCBS Het KompasHet Kompas and CBO Meilân provide Christian education to children in Heerenveen and the surrounding De Fryske Marren municipality, focusing on discovery, personal growth, and social-emotional development.Elementary Schools → Christian Primary Schools 342 Childcare → Before 35 kanjerschool 14 god 515 teacher 2890 school 7856 Friesland → Heerenveen 2578
sluithetaan.nlSluithetaanThe website Sluithetaan offers professional computer, laptop, and Mac repair services, as well as advice on purchasing new equipment. The company is located in Hoogkarspel and serves North Holland, Flevoland, and nationally by appointment.Software Development & Engineering → Computer Technology 288 hardware 941 laptop 1320 computer 1969 software 8291 repair 14576 De Fryske Marren → Lemmer 1188
tukwenjen.nlMunicipality of De Fryske MarrenTûk Wenjen is an energy saving project of the municipality of De Fryske Marren, assisting homeowners in the municipality with making their homes more energy-efficient and sustainable.New Construction → Neighborhood Development 933 Energy → Energy Conservation 89 homeowner 61 tenant 920 subsidy 2649 home 7976 energy 9075
gjhfinancieeladvies.nlJHJ Financial AdviceThe website of GJH Financial Advice provides financial advisory services, including mortgage advice, pension planning, inheritance and gift planning, and guidance through divorce proceedings, emphasizing honesty, transparency, and affordability.Family Law → Divorce 894 Inheritance Law → Wills 200 inheritance 354 divorce 902 pension 1682 planning 1969 mortgage 4564 De Fryske Marren → Joure 689
westfrieslandhypotheken.nlWest-Friesland HypothekenWest-Friesland Hypotheken provides mortgage brokering services in the West-Friesland region.Economy & Finance → Financial News 102 Context 161394 pension fund 163 bank 374 insurer 446 broker 902 mortgage 4564 appointment 13510 De Fryske Marren → Lemmer 1188
stichtingallure.nlStichting AllureThe website of Stichting Allure presents the overarching organization of 15 public primary schools in North Holland, focusing on education and collaboration.Early Years → Childcare 6029 colleague 378 map 801 vision 1882 municipality 6837 school 7856 education 13471 De Fryske Marren → Lemmer 1188
happylift.nlHappyLift BVThe website of HappyLift provides solutions for balancing sliding sash hardware, including springs, closures, and accessories, with a focus on custom-made solutions and warranties.Windows & Doors → Windows 2999 Industry → Industrial 1987 spring 113 ventilation 1110 De Fryske Marren → Lemmer 1188
obsroute0513.nlOBS Route 0513The website of OBS Route 0513 in Heerenveen presents the school, its mission, programs, and facilities, and provides information for parents and prospective students.Elementary Schools → Public Elementary Schools 406 Pediatric & Child Health → Community Care 141 library 988 parent 4318 student 7623 school 7856 education 13471 De Fryske Marren → Joure 689
daltonlemmer.nlDaltonschool Sint Jozef LemmerThe website of Daltonschool Sint Jozef Lemmer provides information about the school, the Dalton method, childcare, and related topics for parents, students, and visitors.Childcare → Daycare Centers 987 Primary Education → Dalton Schools 226 childcare 3512 parent 4318 student 7623 De Fryske Marren → Lemmer 1188
dearke-meilan.nlCBO MeilânThe IKC De Arke and CBO Meilân are a collaborative organization of schools and childcare facilities focused on the holistic development of children in the municipalities of Heerenveen and De Fryske Marren, with a focus on self-discovery, trust, and a positive world view.Early Years → Childcare 6029 vision 1882 childcare 3512 school 7856 child 11566 collaboration 16036 Friesland → Heerenveen 2578
kimjacobidressuurtraining.nlKim Jacobi DressuurtrainingKim Jacobi Dressuurtraining is a dressage stable and instruction business located in Katlijk, Friesland, Netherlands, that trains horses to Grand Prix level and engages in breeding.Animal Husbandry → Horse Breeding 230 Equestrian → Dressage 179 dressage 195 championship 210 instruction 326 breed 1744 horse 4337 news 15293 Heerenveen → Katlijk 43
public-viewing.nlDACHIST.orgThe website Public Viewing in Nederland provides information and an overview of locations where the World Cup and European Championship football games can be viewed publicly, with a focus on the German team and Oranje (the Dutch team).Sports Activities → Football 4144 News & Journalism → Sports News 559 european championship 13 world cup 42 De Fryske Marren → Lemmer 1188
annettedolle.nlAnnette DölleThe website of Annette Dölle presents her services as a speaker, board coach, and process (sor) & developer, offering diverse online learning materials and projects focused on education, care, and social organizations.Management → Corporate Governance 206 e-book 1060 lecture 1624 blog 13392 training 28133 De Fryske Marren → Lemmer 1188
vanlelyveldmakelaardij.nlVan Lelyveld MakelaardijThe website of Van Lelyveld Makelaardij is a platform for buying and selling properties in the Friesland region of the Netherlands. It offers a property listing, valuations, mortgage advice, and other services related to real estate.Property Finance → Purchase 493 Property Sales → Selling Houses 14 realtor 142 purchase 2212 valuation 2697 mortgage 4564 sale 5930 property 7406 Waadhoeke → Tzum 30
bowlenmedemblik.nlBowling Vereniging MedemblikThe website of Bowling Vereniging Medemblik provides information about the association, including news, standings, and tournaments, with a focus on bowling activities in the West-Friesland region.Associations → Sports Associations 1082 Team → Bowling 233 west-friesland 41 bowl 482 tournament 2476 member 10154 De Fryske Marren → Lemmer 1188
pax.nlPAX GroepPAX Groep provides logistical solutions for various industries, including construction and industry, offering services ranging from internal transport to international shipping and project management.Urban Delivery → Urban Logistics 20 logistics 3257 ship 5103 transport 6105 Alphen aan den Rijn → AWZI Alphen a/d Rijn 358
agwf.nlAgrarisch West-FrieslandAgrarisch West-Friesland is a website dedicated to providing all agricultural news and information from the West-Friesland region.Fruit & Orchard Management → Crop Production 123 bulbs 176 livestock 207 horticulture 228 seed 599 agriculture 778 event 45199 De Fryske Marren → Lemmer 1188
defion.nlDefion BVDefion is a power electronics development company that offers a range of services including product certification, development, prototyping, and design.Computer Science → Embedded Systems 141 Engineering → Engineering Firms 989 prototype 603 certification 3380 design 27202 De Fryske Marren → Joure 689
middelzee.nlMiddelzee MotorenMiddelzee Motoren is a Volvo Penta dealer and service center in Friesland, offering a wide range of products and services for water sports enthusiasts.Boating → Engines 52 engine 758 water 2501 part 5044 De Fryske Marren → Goingarijp 86
excelsior-andijk.nlExcelsior AndijkThe website of Excelsior Andijk, a music association, presents information about the association, its activities, members, and contact details.Orchestras → Fanfare Orchestras 244 Associations & Societies → Music Associations 1003 music association 293 conductor 1217 orchestra 1315 repertoire 2497 concert 4409 event 45199 De Fryske Marren → Lemmer 1188
jongsmawonen.nlJongsma WonenThe website of Jongsma Wonen offers complete furnishing solutions for homes and projects, including advice, bespoke upholstery and flooring.Furniture → Upholstery & Fabrics 1045 project furnishing 127 upholstery 673 curtains 1015 bed 1384 floor 4781 De Fryske Marren → Balk 224
pro-av.nlPRO AVThe website PRO AV is the audiovisual specialist of Northern Netherlands, providing complete audiovisual systems and installation solutions.Management & Consulting → Consulting 2127 Technology → Audiovisual & Media 688 audiovisual system 17 sound installation 23 projector 149 installation 13742 De Fryske Marren → Echtenerbrug 24
haringverhuurmakelaar.nlHaring VerhuurmakelaarThe website of Haring Verhuurmakelaar offers services for the worry-free rental of homes, property management, and finding suitable tenants for landlords. It also facilitates the request for rental price appraisals and finding attractive homes.Property Location & Neighborhood → Regional Real Estate 127 Real Estate → Real Estate Technology 40 listings 525 tenant 920 agent 1253 appraisal 1488 rental 7257 home 7976 De Fryske Marren → Lemmer 1188
brouwerongediertebestrijding.nlBrouwer Ongediertebestrijding VofBrouwer Ongediertebestrijding provides professional pest control services in the Heerenveen, Joure, and Friesland region.Control → Pest Control 824 biocide 10 pest 354 control 911 plan 2566 environment 4873 De Fryske Marren → Joure 689
boatcity.nlBoatcityBoatcity is a company in Lemmer that sells a wide selection of sport boats, sport cruisers, and other boats, along with associated services and accessories.Automotive → Sales 1205 winter storage 182 motor 614 boat 2980 maintenance 20093 De Fryske Marren → Lemmer 1188
jouregio.nlUrgendaThe website Jouregio presents local news and events from the Fryslân region, with a focus on the town of Joure.Blogs & Publications → Regional 272 nature 9094 news 15293 event 45199 De Fryske Marren → Joure 689
c-l-int.nlC.L.InternationalC.L.International is a salvage company providing services in North-West Friesland, Terschelling, and Vlieland, and collaborating with various organizations.Road Services → Roadside Assistance 111 recovery 868 transportation 2851 vehicle 3743 insurance 6359 De Fryske Marren → Lemmer 1188
myraborkent.nlPraktijk Myra BorkentThe website of Praktijk Myra Borkent provides psychosocial support to young people and adults, specializing in areas such as adoption, unwanted pregnancy, post-abortion care, teenage parenting, trauma treatment, relationship therapy, and pregnancy loss.Pregnancy & Childbirth → Midwifery 619 adoption 359 parenting 972 trauma 2107 pregnancy 2739 relationship 4205 De Fryske Marren → Lemmer 1188
massagepraktijkoosterzee.nlMassagepraktijk OosterzeeThe website of Massagepraktijk Oosterzee presents massage services and the benefits of massage for health and well-being.Mental & Emotional Well-Being → Anxiety 1169 immune 14 sleep 746 stress 3965 massage 7646 's-Hertogenbosch → Empel 51
occupyschagen.nlOccupy SchagenThe Occupy Schagen website informs about social inequality, abuse of power, and citizen involvement in society.Societal Change → Social Movements 114 Context 161394 column 543 social media 3342 news 15293 De Fryske Marren → Lemmer 1188
bridgefieldblossoms.nlBridgefield BlossomsThe Bridgefield Blossoms website is a kennel specializing in purebred Jack Russell Terriers, with a focus on healthy puppies with a gentle temperament, who are optimally socialized and part of a family.Breeding → Kennels 142 Breed → Jack Russell Terrier 21 jack russell terrier 21 socialization 137 pedigree 232 puppy 1367 dog 5483 health 6366 De Fryske Marren → Balk 224
karyon.nlKaryon Computers & NetwerkenKaryon Computers & Netwerken is an IT service company providing support to individuals and businesses in Southwest Friesland with a variety of IT solutions.IT → Managed Services 720 Computer → Computer Support 1003 backup 494 cloud 1527 data 5872 security 6655 De Fryske Marren → Harich 35
studio13-fotografie.nlStudio13 FotografieStudio13 Fotografie is a photography studio specializing in capturing special moments such as weddings, pregnancies, and portraits, as well as corporate photography.Wedding → Special Events 151 Imaging & Photography → Family & Newborn 1285 memory 1641 pregnancy 2739 portrait 3685 wedding 4258 photography 9503 De Fryske Marren → Balk 224
jongerenvanwestfriesland.nlJongeren van Westfriesland (JWF)The website of Jongeren van Westfriesland (JWF) provides a platform for young people aged 18 to 39 in West-Friesland to connect, develop themselves, and participate in activities, as well as an online community for connection.Social Organization → Youth Organizations 1726 Youth → Young People 30 young people 1045 donation 5110 community 7931 volunteer 8367 De Fryske Marren → Lemmer 1188
beyondnow.nlBeyond NowBeyond Now is an organization focused on creating surprising and impactful living environments and promoting healthy and inclusive communities.Social Issues → Community Development 330 Living → Living Environment 73 green 889 festival 3804 home 7976 collaboration 16036 De Fryske Marren → Joure 689
dejongopticiens.nlDe Jong OpticiensDe Jong Opticiens is an optician located in Balk, Friesland, offering eye measurements, eyeglasses, and contact lenses.Specialty Medicine → Optometry 539 Services → Opticians 551 eye measurement 232 eyeglasses 437 contact lenses 538 family business 793 glass 2919 De Fryske Marren → Balk 224
wsvdeven.nlWaterski and wakeboard association WSV de VenWaterski and wakeboard association WSV de Ven offers water sports activities such as waterskiing, wakeboarding, and watersurfing in Enkhuizen.Associations → Sports Associations 1082 Water Sports → Waterskiing 42 waterskiing 28 wakeboarding 31 team building 720 sport 4228 association 8562 De Fryske Marren → Lemmer 1188
sterkfood.nlSterk Seafood b.v.Sterk Seafood is a wholesale office and importer of frozen fish, and also produces high-quality finished products.Wholesale → Fish Wholesalers 15 Restaurants & Dining → Seafood Restaurants 612 shellfish 46 fish 1121 snack 2916 production 4582 assortment 7799 De Fryske Marren → Lemmer 1188
zuidwestfrieslandonstage.nlOn StageOn Stage is an initiative that connects vmbo- and practical school students with careers and companies.Career & Guidance → Career Planning 375 career 2513 partner 4272 student 7623 education 13471 event 45199 Southwest-Friesland → Koudum 134
kykscholen.nlKyK ScholenKyK Scholen is a collaborative network of primary schools in the Harlingen region providing public education.Special Needs & Support → Educational Organizations 315 Primary & Secondary Schooling → School Types 20 lef 11 professionals 1966 parent 4318 municipality 6837 child 11566 education 13471 Friesland → Harlingen 978
vitrotint.nlAutobedrijf StoeboThe website of Autobedrijf Stoebo provides car advertising, window tinting, and lettering services for individuals and businesses in the Bolsward, Sneek, and South West Friesland region.Car Care & Detailing → Detailing 941 Transportation → Automotive Care 185 car advertising 19 carwrap 42 window film 135 rental car 178 vehicle 3743 installation 13742 De Fryske Marren → Lemmer 1188
noordnederlandinterieurs.nlNoord Nederland InterieursNoord Nederland Interieurs is an interior company specializing in custom-made furniture and interior construction, with a long history and a focus on customer satisfaction and sustainability.Woodwork → Wooden Furniture 476 interior 8093 furniture 8751 sustainability 18451 De Fryske Marren → Joure 689
autorecyclingjoure.nlAutorecycling Joure b.v.The website of Autorecycling Joure describes an auto salvage yard that sells car parts, donor cars, and tires, and is committed to environmental protection.Waste Management → Waste Processing 96 Road Services → Automotive 18764 auto parts 44 waste 1312 tire 1975 valuation 2697 part 5044 De Fryske Marren → Joure 689
logeerderijdekukel.nlLogeerderij de KukelLogeerderij de Kukel is a holiday house and B&B located in Zwaag, offering a relaxing vacation experience.Context 161394 holiday house 402 vacation 4234 environment 4873 house 8121 De Fryske Marren → Lemmer 1188
technieker.nlTechniekerThe website ‘Technieker’ is a job board specializing in technical roles, with a focus on the manufacturing and processing industry in Northern Netherlands. The aim is to offer challenging career opportunities to professionals seeking a new challenge.Technical Services → Technical 957 Employment & Labor → Employers 608 position 875 motivation 894 automation 2682 vacancy 6598 technology 6816 Northeast-Friesland → Dokkum 846
kaatkrabbelt.nlKaatKrabbelThe website is a personal blog where the author shares her experiences, thoughts, and reflections on various topics, including parenting, health, personal growth, and leisure activities.Personal Blog → Life Stories 32 Personal Blog → Reflection 821 eeg 18 parenting 972 life 2673 travel 7210 blog 13392 De Fryske Marren → Lemmer 1188
delichtadviseurs.nlDE lichtadviseursThe website of DE lichtadviseurs is a platform that provides lighting advice, lighting supply and installation services to professionals and individuals, with a focus on a total solution and a wide range of brands.Lighting → LED Lighting 574 Consulting → Lighting Consulting 78 lighting advice 52 lighting plan 200 light 5148 assortment 7799 quote 12863 Smallingerland → Drachten 2052
aksescatering.nlAkse's CateringAkse's Catering is a catering company that caters to both private and business events, including a food truck, and focuses on professional and hospitable service.Quick Bites → Food Trucks 623 Business Services → Business Activities 230 foodtruck 613 catering 6456 quote 12863 event 45199 De Fryske Marren → Lemmer 1188
vvbl.nlVereniging van Bedrijven Lemmer en omstrekenThe Vereniging van Bedrijven Lemmer en omstreken (VVBL) is a business association focused on fostering collaboration, knowledge sharing, and networking among companies in Lemmer and the surrounding area. The website provides information about events, members, contact details, and opportunities to join.Associations → Regional Associations 292 networking 842 member 10154 collaboration 16036 event 45199 Southwest-Friesland → Heeg 227
2carrots.nl2carrotsThe website 2carrots is an online shop specializing in supplies for corsets and clothing accessories, including custom-made corsets.Underwear → Lingerie 471 corset 23 lace 53 stay 702 De Fryske Marren → Langweer 93
dekampeertuin.nlDe KampeertuinMinicamping De Kampeertuin is a small campsite located in West Friesland, offering camping facilities and a relaxing vacation experience.Farms & Farm Businesses → Fruit Farms 197 Camping → Campsites Netherlands 792 apple tree 14 grass 238 orchard 240 cycle 1906 campsite 2093 Drechterland → Wijdenes 46
mammoetwoongigant.nlMammoet WoongigantMammoet Woongigant is a large home store in West Friesland offering everything for a complete home furnishing setup.Living & Dining → Living Room Furniture 163 garden furniture 578 curtains 1015 bedroom 2051 floor 4781 interior 8093 furniture 8751 De Fryske Marren → Lemmer 1188
blijnienke.nlBlij NienkeThe website BlijNienke.nl presents the services of Nienke Bussink, a mental coach, who helps individuals and young people to realize their potential and develop a more positive view of themselves.Dog Training → Behavior 413 behavior 1779 plan 2566 goal 4974 coach 25810 De Fryske Marren → Lemmer 1188
kuunstig.nlGalerie KuunstigThe website of Galerie Kuunstig presents artwork and is located in Echten, Drenthe, on a historic site.Exhibitions → Art Fairs 196 Artists & Studios → Galleries 1398 havezate 11 sheep 274 gallery 1983 art 3856 exhibition 5332 De Fryske Marren → Echten 54
abbsdereinboge.nlABBS De ReinbôgeThe website of ABBS De Reinbôge informs parents and stakeholders about the school, its activities, and practical information.Primary Education → School Districts 27 Village Focus → Village Life 262 teacher 2890 parent 4318 school 7856 De Fryske Marren → Bantega 19
bergsmavakman.nlBergsma Vakman BalkBergsma Vakman Balk is a DIY store offering a wide range of materials, tools and accessories for both professionals and individuals.Machinery & Repair → Machinery 1045 Building & Construction → DIY 1007 skates 148 blinds 446 tool 3907 De Fryske Marren → Balk 224
hen3ka.nlHen3kaThe website Hen3ka.nl offers interior design advice, home decor and upholstery services to individuals and businesses, provided by a certified interior designer and stylist.Decor & Furnishings → Interior Design 2317 home decor 400 upholstery 673 online shop 1310 atelier 1417 interior design 1802 De Fryske Marren → Sint Nicolaasga 146
tjittedewolff.nlTjitte de WolffThe website of Tjitte de Wolff is a supplier and maintenance company for machinery, tools, and parts for agriculture, industry, and horticulture.Machinery & Repair → Mechanization 60 Machinery & Repair → Machinery 1045 machinery 519 agriculture 778 tool 3907 showroom 4883 workshop 19325 maintenance 20093 De Fryske Marren → Tjerkgaast 16
beautyweekend.nlBeautyweekend B.V.The website offers an overview of beauty arrangements and weekend getaways in various regions of the Netherlands and Germany.Hiking → Europe 51 Context 161394 weekend 383 wellness 1561 arrangement 3104 hotel 3543 massage 7646 treatment 21203 Bergen → Egmond aan Zee 362
natuurbegraafplaatsfriesland.nlNatuurbegraafplaatsen FrieslandThe website provides information about natural burial grounds located in Friesland, Netherlands, and details about the practice of natural burial and available locations.Life Events → Death 687 Funeral Services → Funeral Arrangement 486 natural burial ground 15 natural burial 25 friesland 692 brochure 1642 De Fryske Marren → Sondel 14
readyforliving.nlReadyforLivingReadyforLiving is a developer of turnkey new construction projects in the Netherlands.New Construction → Projects 257 purchase price 10 apartment 5088 home 7976 De Fryske Marren → Lemmer 1188
hieke.nlHieke KramerThe website of Hieke.nl offers graphic design and web design services, with a focus on designing logos, brand identities, websites, and print materials for businesses and individuals in the Joure, Heerenveen, and surrounding area.Design → Graphic Design 2433 print materials 57 brand identity 1457 logo 4660 communication 10162 brand 17737 Southwest-Friesland → Sneek 1921
mariz.nlMarizThe website of Salon Mariz offers beauty treatments, an online shop, and a beauty academy.Eyelash Services → Eyebrows 777 Services → Massage Practices 376 attention 570 academy 593 atmosphere 5591 shop 6483 treatment 21203 De Fryske Marren → Lemmer 1188
w2n.nlW2N EngineersThe website of Bouwkundig ingenieursbureau W2N Engineers presents the services of a civil engineering firm that provides multidisciplinary advice on construction, building physics, and energy performance, with a particular focus on roof checks for solar panels.Engineering → Engineering Firms 989 building physics 47 energy performance 47 construction 7421 Smallingerland → Drachten 2052
jachtwerfzevenbergen.nlJachtwerf Zevenbergen LemmerThe website of Jachtwerf Zevenbergen Lemmer presents a family-run business specializing in complete yacht services, including maintenance, renovation, repair, and winter storage of boats.Boating → Boat Maintenance 183 Water → Boats 935 winter storage 182 yacht 647 boat 2980 paint 8747 maintenance 20093 De Fryske Marren → Lemmer 1188
warniermetaal.nlWarnier MetaalThe website of Warnier Metaal describes their activities as a company specializing in metalworking, machine construction, and the provision of various products and services to different industries.Metalworking → Welding 893 Technology → Robotics & Automation 860 machine construction 146 robotics 281 cnc 305 metalworking 565 De Fryske Marren → Joure 689
keurtekens.nlKeurtekensThe Keurtekens.nl website provides information about hallmarks, master hallmarks, importer's marks, and responsibility marks used in gold, silver, and platinum, focusing on the Guarantee Act and the CCM convention. The website also offers information about testing gold and silver and the meaning of year letters.Investing → Precious Metals 326 Government & Administration → Legislation 432 hallmark 23 silver 479 gold 805 De Fryske Marren → Joure 689
campingzonneheuvel.nlCamping ZonneheuvelCamping Zonneheuvel is a campsite in Friesland, Netherlands, offering access to forests and the IJsselmeer lake.Camping → Campsites Netherlands 792 forest 1418 campsite 2093 relaxation 3968 family 6462 De Fryske Marren → Oudemirdum 73
autismenh.nlAutism Network North Holland NorthThe website aims to present the collaboration and the support offered for people with Autism Spectrum Disorder (ASD) and their environment.Mental & Emotional Well-Being → Autism 958 Government & Administration → Municipal Services 834 autism spectrum disorder 10 life 2673 care 12338 De Fryske Marren → Lemmer 1188
kloosterpoffertjes.nlKlooster PoffertjesThe Klooster Poffertjes website promotes and offers the rental of traditional Dutch poffertjes stalls for various events.Event Styling & Decoration → Event Equipment 775 cotton candy machine 16 event 45199 De Fryske Marren → Sint Nicolaasga 146
vanderveldedakkapellen.nlVan der Velde DakkapellenVan der Velde Dakkapellen is a specialized company that supplies and installs custom-made skylights.Roofing → Skylights 471 Renovation → Attic Renovation 37 attic 112 skylight 966 plastic 1232 warranty 4701 Westerkwartier → Lauwerzijl 12
skotwal.nlSkotwalThe website of Skotwal provides information about the band, their schedule, albums, and concerts, and gives background on their 15-year history and the recent decision to temporarily halt the band to rediscover its direction.Popular → Rock 942 band members 30 album 1495 band 2977 concert 4409 De Fryske Marren → Lemmer 1188
dox.nlDox ImagemakersThe website of Dox Imagemakers from Joure offers advertising and signage materials aimed at strengthening brand identity and attracting customers.Advertising → Lettering 569 carwrap 42 facade 1490 advertising 2302 design 27202 De Fryske Marren → Joure 689
campingdetjasker.nlBoerderijcamping de TjaskerBoerderijcamping De Tjasker is a campsite offering a peaceful vacation in a unique environment.Camping → Campsites Netherlands 792 Nature → Forest 387 lake 352 peace 1113 forest 1418 campsite 2093 vacation 4234 De Fryske Marren → Wijckel 25
totalhaircare.nlTotal Hair CareThe website of 'Total Hair Care' is a hair salon located in Lemmer-Noord that offers a wide range of hairstyles and styling advice for the entire family, with a focus on color techniques and the use of high-quality, eco-friendly products.Salons → Men’s Hair Salons 79 color technique 17 styling advice 96 hairdresser 1372 salon 5541 De Fryske Marren → Lemmer 1188
rvandermolenlmb.nlR. van der Molen MechanizationThe website of R. van der Molen Mechanization offers hydraulic systems, used construction machinery and parts, as well as mechanization services.Industrial Equipment & Services → Machine Building 665 Machinery & Repair → Machinery 1045 recycled materials 20 hydraulic system 50 construction machinery 105 technician 815 part 5044 De Fryske Marren → Echten 54
jjws.nlJulia Jan Wouters StichtingThis website documents the history and purpose of the Julia Jan Wouters Stichting, including requests for financial support and future policies.Local History → Dutch History 1067 Government & Legal → Trusts 15 wealth 275 family 6462 foundation 6678 Southwest-Friesland → Workum 363
autojourexl.nlAuto Joure XLAuto Joure XL is an auto dealership located in Joure that specializes in the sale, financing, and export of used cars.Leasing → Auto Leasing 565 Financing → Leasing 1065 export 630 used car 825 lease 1595 warranty 4701 finance 5341 De Fryske Marren → Joure 689
wandelarrangement.nlWandelarrangement.nlThe website Wandelarrangement.nl offers walking tours in the Netherlands and Belgium, featuring hotel arrangements in beautiful locations.United States → New York 36 Accommodation → Resorts 229 tours 1048 destination 2580 arrangement 3104 reservation 3373 hotel 3543 quote 12863 Drimmelen → Made 335
fietsarrangement.nlFietsarrangementThe website provides information and booking options for various cycling arrangements in the Netherlands and Germany, including themed arrangements, day trips, and vacations.Europe → France 1041 Cycling → Cycling Holidays 295 germany 185 netherlands 1376 cycle 1906 arrangement 3104 Drimmelen → Made 335
partytenthuren-friesland.nlPartytentverhuur FrieslandThe website offers tent rentals and various accessories for events in Friesland.Event Rental → Tent Rental 437 Events & Hospitality → Catering Equipment 50 tent 1328 floor 4781 light 5148 furniture 8751 accessories 12975 event 45199 Northeast-Friesland → Dokkum 846
schuldhulpmaatje-wf.nlSchuldHulpMaatje West-FrieslandSchuldHulpMaatje West-Friesland provides free assistance with financial concerns, aiming to prevent and solve financial debt problems.Debt Relief → Debt Management 80 Debt Relief → Debt Counseling 288 debt 717 financial 855 finance 5341 volunteer 8367 De Fryske Marren → Lemmer 1188
tjongerkozijn.nlTjonger KozijnThe website of Tjonger Kozijn presents itself as a supplier and installer of plastic frames, doors, skylights, and facade cladding, with a focus on Friesland and sustainability.Frames → Plastic Frames 340 Maintenance & Services → Facade Maintenance 673 facade cladding 384 skylight 966 door 2210 frames 2556 quote 12863 sustainability 18451 Weststellingwerf → Wolvega 524
slijterijtulner.nlSlijterij TulnerThe Slijterij Tulner website offers the sale of homemade drinks and specialties, particularly from the island of Schiermonnikoog and its surroundings, and has been active since 1904.Supermarkets & Grocery → Food Stores 1058 Context 161394 specialty 229 recipe 5142 drink 5191 sale 5930 history 7286 Heerenveen → Akkrum 246
jouwworkshops.nlJouw WorkshopsThe website offers a range of creative workshops in Drenthe, including sculpting, painting, and themed workshops, and provides options for group activities and individual workshops. The company focuses on events such as corporate parties and bachelor/bachelorette parties.Creative Spaces & Events → Creative Arts 128 Art & Culture → Art Events 327 creative 539 studio 5465 paint 8747 workshop 19325 event 45199 Het Hogeland → Zuidwolde 359
bedrijfsevents.nlEvent Creatie BVThis website offers the organization of corporate events and outings, with a focus on unique and experience-oriented events.Conferences & Meetings → Corporate Events 2472 Ticketing & Sales → Packages 35 corporate event 224 outing 982 theme 4015 package 6112 The Hague → Scheveningen 1625
friesemerencampings.nlFriese Meren CampingsThe website of Friese Meren Campings provides information about various campsites located around the Heegermeer/Fleussen in Friesland, emphasizing small-scale charm, a natural setting, and recreational opportunities.Camping → Camper Stops 33 campsite 2093 water 2501 boat 2980 route 3425 accommodation 4921 nature 9094 Southwest-Friesland → Sandfirden 13
grootmedia.nlGrootMediaThe website of GrootMedia presents their services as a local media partner, focusing on increasing brand awareness, finding employees, and offering advertising opportunities for businesses in Friesland.News & Journalism → Regional News 948 medium 1293 advertising 2302 resident 3245 region 5412 brand 17737 Southwest-Friesland → Sneek 1921
vajoure.nlVoetbalacademie JoureThe website of Voetbalacademie Joure presents a training program for footballers and goalkeepers, aimed at children aged 7 to 16, and offers training sessions and events in Joure, Bolsward, and Wolvega.Sports & Fitness → Sports Training 711 football academy 10 goalkeeper 62 tournament 2476 training 28133 Weststellingwerf → Wolvega 524
bouwbedrijf-schotanus.nlBouwbedrijf Schotanus b.v.The website of Bouwbedrijf Schotanus presents news, projects, and company information, focusing on construction activities and anniversary events.Local & Regional Focus → Local Businesses 1077 Local Events → Neighborhood Events 57 anniversary 670 foundation 6678 construction 7421 house 8121 renovation 13849 Northeast-Friesland → Kollumersweach 73
kajoure.nlKeepersacademie JoureThe Keepersacademie Joure provides training for goalkeepers aged 7 to 16, with the goal of developing their talent and helping them improve.Education → Sports Education 247 goalkeeper 62 level 494 academy 593 talent 3987 collaboration 16036 training 28133 Weststellingwerf → Wolvega 524
karenvisserontwerp.nlKaren Visser Graphic DesignThe website of Karen Visser Graphic Design showcases a portfolio of graphic design work, ranging from posters and logos to stand and packaging designs, and offers services for various projects.Design & Creative → Graphic Services 1003 stand 294 poster 837 brand identity 1457 brochure 1642 packaging 2236 logo 4660 De Fryske Marren → Balk 224
kapsalonjeannet.nlKapsalon JeannetKapsalon Jeannet Balk is a hair salon that offers hairdressing services and products with a focus on personalized attention and an individual hair analysis.Salons → Individual Hairdressers 51 hairstyle 812 appointment 13510 De Fryske Marren → Balk 224
lekkerepoffertjes.nlPoffertjeskramen R.P. Klooster V.O.F.The website promotes the rental of a poffertjes stall operated by Richard Klooster, offering delicious poffertjes at various events and locations.Local Events → Fairs 707 Sandwiches & Salads → Snacks 693 poffertjes 36 market 2772 De Fryske Marren → Sint Nicolaasga 146
nieuwbouw-de-fryske-marren.nlNieuwbouw De Fryske Marren (De Friese Meren)The website Nieuwbouw De Fryske Marren (De Friese Meren) provides information and listings for new construction projects, for sale and rent, in the region of De Fryske Marren (De Friese Meren).New Construction → Neighborhood Development 933 new construction project 79 region 5412 property 7406 De Fryske Marren → Lemmer 1188
tijsmawijn.nlWijnhuis Gerard TijsmaThe website of Wijnhuis Gerard Tijsma is an online wine supplier, focusing on quality wines from various European countries, including organic wines, and providing wine delivery to individuals and organizations.Gifts & Souvenirs → Wine Shops 796 payment request 13 wine 4476 assortment 7799 De Fryske Marren → Balk 224
feroaring.nlFeroaringThe Feroaring website presents and promotes the rental of lemsteraaks (traditional sailboats) for sailing trips on the IJsselmeer and Friesian lakes, catering to various events such as corporate outings and courses.Boating → Marinas 825 lemsteraak 20 sailing trip 91 catering 6456 event 45199 Eemsdelta → Wirdum 54
enkhuizerbedstede.nlThe Enkhuizer BedstedeThe Enkhuizer Bedstede is a specialist in beds, boxsprings, mattresses, and related accessories, offering personal advice and selling various brands.Beds → Boxsprings 229 Bedroom → Bedding 940 boxsprings 155 mattress 899 bed 1384 brand 17737 De Fryske Marren → Lemmer 1188
personeelsvereniging.nlPersoneelsverenigingThe website offers suggestions and organization options for team outings, company outings, and staff parties.Family Activities → Outings 763 Corporate Events → Corporate Outings 878 company outing 166 outing 982 meeting 2381 party 5928 Voorst → Teuge 112
eclatant.nlEclatant Cleaning CompanyThe website of Eclatant Cleaning Company is dedicated to offering professional cleaning services to both private and business customers, with a wide range of specialties including window cleaning, floor maintenance, facade cleaning, and emergency services.Maintenance & Repair → Facility Services 671 floor maintenance 188 window cleaning 348 emergency service 372 facade cleaning 385 cleaning 4567 Westerkwartier → Zuidhorn 286
totalcarhifi.nlTotal Car HifiThe website of Total Car Hifi is a specialist in carhifi, cardetailing and carcomfort, with a focus on sales, installation and advice in North Holland.Car Care & Detailing → Detailing 941 Installation & Repair → Audio Installation 10 car detailing 73 De Fryske Marren → Lemmer 1188
astridwormgoor.nlAstrid WormgoorThe website of naturopathic practitioner Astrid Wormgoor presents her services in the areas of bioresonance, nutritional advice, and massage, aimed at improving the health and vitality of her clients.Alternative Medicine → Orthomolecular Medicine 340 Alternative Medicine → Naturopathy 1097 digestive issues 44 bioresonance 137 nutritional advice 317 health 6366 massage 7646 De Fryske Marren → Joure 689
braem.nlBraem Re-Creatie OntwerpBraem Re-Creatie Ontwerp is a design studio specializing in the creative design and repurposing of camping sites and rental accommodations.Camping → Nature Camping 66 repurposing 41 camp 2466 accommodation 4921 De Fryske Marren → Oudemirdum 73
bokma-oudemirdum.nlTechnisch Bedrijf BokmaThe website of Technisch Bedrijf Bokma presents the store and its product range, located in Oudemirdum, and informs visitors about opening hours and the various product categories.Electronics & Components → Television 262 white goods 63 installation materials 79 television 709 light 5148 repair 14576 De Fryske Marren → Oudemirdum 73
historischekringeenrum.nlHistorische Kring EenrumThe Historische Kring Eenrum aims to research and preserve the history of the former municipality of Eenrum and its surrounding villages.Local History → Northern Groningen 32 Social Sciences → Genealogy & Family History 1403 photo book 135 publication 2018 archive 2067 history 7286 Het Hogeland → Pieterburen 80
autogroothandelfriesland.nlAutogroothandel Friesland B.V.The website of Autogroothandel Friesland is a wholesaler specializing in vehicles for business clients and selling used cars, excluding sales to private individuals. The company offers a wide selection, expert advice, and export services.Car Selling & Valuation → Passenger Cars 992 export 630 inventory 1613 price 8328 car 10865 De Fryske Marren → Joure 689
beheerwelzijn.nlBeheer WelzijnBeheer Welzijn is a foundation that manages properties and rents out spaces in various municipalities of the province of Friesland and surrounding areas.Office Space → Rental Space 537 Logistics → Storage 1170 hall 1786 space 3846 municipality 6837 rental 7257 property 7406 Aa en Hunze → Gieten 225
buurtbestuurders.nlBuurtbestuurdersBuurtbestuurders is a project aimed at making electric sharing cars accessible in Friesland, specifically through collaboration with energy cooperatives, village interests, and sports associations.Local Government → Village Council 479 Fuel & Energy → Sustainable Transportation 114 energycooperative 160 pilot 208 De Fryske Marren → Balk 224
slagerijdevriesoudemirdum.nlSlagerij De VriesThe website of Slagerij De Vries in Oudemirdum presents the butcher shop and its offerings, focusing on traditional meat, meat products, and specialties.Supermarkets & Grocery → Butchers 747 dry sausage 10 meat products 272 tradition 736 meat 2055 De Fryske Marren → Oudemirdum 73
lekkermakkelijkhamstra.nlLekker Makkelijk HamstraLekker Makkelijk Hamstra is a company that delivers groceries and offers gift packages.Supermarkets & Grocery → Local Supermarkets 56 delivery service 236 groceries 358 gift package 530 barbecue 1175 order 6912 De Fryske Marren → Oudemirdum 73
restaurantdenostalgie.nlBar and Restaurant De NostalgieRestaurant De Nostalgie is a restaurant located in Oudemirdum, Gaasterland, offering seasonal and creative dishes.Cafes → Dutch Restaurants 1031 brink 44 reservation 3373 dish 5936 restaurant 11215 menu 13856 De Fryske Marren → Oudemirdum 73
lemsterglas.nlLemsterglasThe website of Lemsterglas showcases the handcrafted glass engraving services of Alie Winters, who creates custom glass and mirror engravings, including traditional Christmas and birthday balls, and newer DECO items with printing.Crafts → Glassworking 581 Commerce → Gift Industry 32 christmas ball 29 glass 2919 decoration 4085 workshop 19325 design 27202 Meierijstad → Veghel 1288
toanhus.nlToanhûsThe Toanhûs is an arts center in De Fryske Marren offering lessons and activities in music, dance, theater, and art & design.Dance → Dance Classes 1003 Institutions → Cultural Centers 610 dance 1834 theater 2544 art 3856 music 13170 course 14728
deblijepapegaai.nlStichting De Blije PapegaaiThe Blije Papegaai is an organization that hosts birthday parties, workshops, and craft kits.Workshops → Children’s Workshops 77 Family Fun → Family Activities 1493 craft kit 45 birthday party 223 friesland 692 workshop 19325 De Fryske Marren → Joure 689
delangestreek.nlDe LangestreekDe Langestreek is a company offering home and project furnishing services, including flooring, window coverings, and sleep comfort solutions.Interior → Flooring 2791 Design & Creative → Interior Design Companies 11 home furnishing 113 curtains 1015 window coverings 1213 floor 4781 showroom 4883 De Fryske Marren → Lemmer 1188
oanepoel.nlWaterpark Oan ‘e PoelThe website of Waterpark Oan ‘e Poel in Terherne, Friesland, offers holiday homes and lodges for rent on the Sneekerermeer, with a focus on comfort, space, and access to water activities.Accommodation → Villas 1018 Water → Boating 1592 hot tub 260 lodge 340 water 2501 holiday home 2753 bicycle 2838 De Fryske Marren → Terherne 98
gymnasionjoure.nlVereniging Exclusieve SportcentraSportcentrum Gymnasion in Joure offers a wide range of sports and fitness options, including swimming lessons, group classes, and personal coaching, with the goal of helping customers improve their quality of life.Group Class → Fitness Centers 1010 Personal & Household → Fitness Services 162 gym 699 swimming 850 group classes 1306 fitness 2251 membership 10442 coach 25810 De Fryske Marren → Joure 689
piaservice.nlPIA Service BVThe website PIA Service presents itself as a provider of industrial automation solutions, specifically focused on processing and production machines and processes in the food and non-food sector. The company offers software, service, and consultancy services, with the goal of optimizing production processes.Automation & Control → Automation 1494 Industrial → Industrial Automation 1042 process control 13 scada 37 iot 183 automation 2682 production 4582 software 8291 De Fryske Marren → Joure 689
affourtit.nlAffourtit DesignThe Affourtit Design website showcases and sells unique lamps designed and crafted by Maarten Affourtit, utilizing recycled materials primarily wood and other found objects from the surrounding environment.Hobbies → Collecting 386 Decorative Arts & Crafts → Handmade Art 56 recycled materials 20 photographs 254 lamp 1142 wood 4153 design 27202 De Fryske Marren → Lemmer 1188
molenaarjachtwerfdehemmes.nlMolenaar JachtbouwMolenaar Jachtbouw is a company that rents motorboats and yachts and also builds them themselves.Marine & Watercraft → Water Transportation 446 Marine & Shipping → Maritime 1022 boat building 11 motorboat 128 yacht 647
kaasnotenwijn.nlKaas Noten & Wijn - BruinsmaThe website Kaas Noten & Wijn - Bruinsma offers an online shop with a diverse range of cheese, nuts, and wine, as well as corporate gifts and gift baskets.Dairy → Cheese 530 Gifts → Gift Cards 981 delicacies 273 nuts 417 cheese 1205 wine 4476 package 6112 gift 6442 De Fryske Marren → Lemmer 1188
pianolessenfriesland.nlpianolespraktijk Pauli YapThe website of pianolespraktijk Pauli Yap offers piano lessons in South West Friesland, catering to both beginners and advanced students.Music → Music Education 2015 piano lessons 346 piano 820 choir 3123 Southwest-Friesland → Workum 363
solexverhuurfriesland.nlSolexverhuur FrieslandSolexverhuur Friesland offers rentals of Solexes, E-chopper rides, and DAF tours for various occasions.Planning → Tours 870 Planning → Travel Packages 12 daf 51 solex 61 tours 1048 arrangement 3104 event 45199 De Fryske Marren → Lemmer 1188
wokming.nlWOK MINGThe website of WOK MING in Joure presents an all-inclusive wok restaurant with takeaway, catering, and reservation options, and offers a selection of Asian dishes, including soups, woks, sushi, and teppanyaki.Japanese → Sushi 971 Catering & Ready Meals → Asian Restaurant 163 wok 231 soup 1043 sushi 1695 catering 6456 restaurant 11215 De Fryske Marren → Joure 689
spotlangweer.nlSPOT LangweerThe SPOT Langweer website presents the restaurant, located in Langweer, Friesland, and provides information about the menu, events, and reservation options.Cafes → Grand Cafés 228 Venues & Rentals → Venues 2044 terrace 4847 restaurant 11215 menu 13856 event 45199 De Fryske Marren → Langweer 93
restaurantdeklokkenstoel.nlRestaurant De KlokkenstoelRestaurant De Klokkenstoel is a restaurant and event location in Goingarijp, Friesland, that also offers business events.Catering & Ready Meals → European Cuisine 61 Venues → Wedding Venues 232 wedding venue 91 water 2501 atmosphere 5591 restaurant 11215 event 45199 De Fryske Marren → Goingarijp 86
toegankelijkvaren.nlStichting Toegankelijk VarenThe website of the Stichting Toegankelijk Varen provides information about accessible boat tours for people with physical disabilities in the Gaasterland and Balk region.Volunteering → Volunteer Organizations 683 Water Travel → Boat Tours 640 lift 445 target group 578 tour 2315 boat 2980 foundation 6678 De Fryske Marren → Balk 224
slagerijdol.nlSlagerij DolThe Slagerij Dol website is an online shop and local butcher shop with a long tradition, selling fresh meat, meat products, delicatessen, and barbecue products, with delivery service in various villages in the area.Supermarkets & Grocery → Butchers 747 sausage 256 barbecue 1175 meat 2055 assortment 7799 De Fryske Marren → Boornzwaag 17
praktijkdelevensvisie.nlPraktijk de LevensvisieThe website Praktijk de Levensvisie offers alternative holistic therapies and coaching services, focused on women seeking healing, personal growth, and a deeper connection with their own essence.Therapy → Holistic Therapy 889 Professional Services → Coaches 90 transformation 1081 vitality 1726 coach 25810 De Fryske Marren → Lemmer 1188
wijnkoperij-joure.nlWijnkoperij JoureWijnkoperij Joure is a webshop and physical store offering a wide selection of wines and whiskies.Wine → Wine Tasting 730 Gifts & Souvenirs → Wine Shops 796 whisky 373 taste 933 wine 4476 gift 6442 webshop 8648 De Fryske Marren → Joure 689
rotaryapeldoornzuid.nlRotary Club Apeldoorn-ZuidThe website of Rotary Club Apeldoorn-Zuid presents the activities and projects of this active service club, with a focus on community engagement and fellowship.Volunteering → Service Clubs 171 Religious Life → Social Activity 229 fellowship 53 rotary club 71 tour 2315 donation 5110 community 7931 De Fryske Marren → Lemmer 1188
ankerlemmer.nl‘t Anker Woontrends‘t Anker Woontrends is a store that sells furniture, fashion, and interior design advice.Gifts & Occasions → Flower Shops 776 Retail & Commerce → Retailers 754 interior design advice 129 whatsapp 382 facebook 850 instagram 1216 fashion 2212 furniture 8751 De Fryske Marren → Lemmer 1188
campingdegroninger.nlCamping de GroningerThe website of Camping de Groninger presents a farm campsite located in Gaasterland and offers information about facilities, locations, and contact details.Landscape → Polders 212 Camping → Farm Camping 386 campsite 2093 farm 2622 route 3425 nature 9094 Southwest-Friesland → Hindeloopen 127
kongafloat.nlKonga FloatThe Konga Float website presents a floating accommodation in the Friesian lakes, designed for a tranquil and nature-based lifestyle. It describes the design, construction, and philosophy behind this unique experience.Water → Boating 1592 Fishing → Carp Fishing 129 float 159 cabin 351 lake 352 solar energy 373 nature 9094 design 27202
pompebledsjes.nlPompeblêd Sieraden WebshopThe website is a webshop selling pompeblêd (a Friesian flower) jewelry in gold and silver, designed and handcrafted by Simone in Joure.National Identity → Frisian Culture 11 jewelry 4599 webshop 8648 workshop 19325 De Fryske Marren → Joure 689
restaurantdewildeman.nlRestaurant de WildemanRestaurant de Wildeman Lemmer is a historic inn and restaurant offering event spaces for celebrations and parties, and is currently seeking a new chef and staff.Cafes → Dutch Restaurants 1031 inn 82 chef 631 catering 6456 event 45199 De Fryske Marren → Lemmer 1188
villascorpio.nlVilla ScorpioVilla Scorpio is a holiday home in Gaasterland, Friesland, accommodating up to 12 people, situated in the Gaasterland forests near the IJsselmeer lake and forest. It offers accommodation for families and individuals seeking a tranquil holiday in a natural setting.Water Travel → Boat Tours 640 Accommodation → Bungalows 1008 watersport 540 forest 1418 holiday home 2753 nature 9094 De Fryske Marren → Rijs 32
woningscharsterbrug.nlWoning ScharsterbrugThe website offers rental of a house in Scharsterbrug, Friesland, focusing on exploring the surrounding area and providing activities for families and friends.Accommodation → Bungalows 1008 Accommodation → Bungalow Parks 931 watersport 540 hiking 841 swimming pool 1664 cycle 1906 house 8121 Amsterdam → Sloten 146
mantelvoors.nlMantel & Voors notarissenMantel & Voors notarissen is a notary office located in West-Friesland providing legal advice, mediation and agricultural support.Legal → Notaries 848 agricultural 142 will 510 notary 791 legal advice 888 mediation 2787 Medemblik → Andijk 242
parkmanagementbolsward.nlVereniging Parkmanagement BolswardThis website provides information about park management and the stakeholders involved in the business park of Bolsward.Municipalities → Governance 1043 Commercial Property → Business Parks 324 park management 65 business park 372 municipality 6837 collaboration 16036 Southwest-Friesland → Bolsward 566
grytsjekingma.nlGrytsje KingmaThe website introduces Grytsje Kingma, a Friesian singer who writes and performs her own Dutch-language songs, often for organizations and events.Traditional → Folk Music 299 Cultural Events → Musical Performances 38 friesland 692 singer 860 guitar 1091 song 1285 choir 3123 performance 7586 De Fryske Marren →  Sintjohannesga 24
zorginsudwest.nlGemeente Súdwest-FryslânThe website ‘Zorg in Súdwest-Fryslân’ is a platform of the municipality of Súdwest-Fryslân where residents can express their opinions on the future of healthcare in the municipality, specifically regarding the potential closure of hospitals and the development of new facilities.Municipalities → Súdwest-Fryslân 11 Health → Medical Care & Services 29461 opinion 417 hospital 560 healthcare 2316 plan 2566 Southwest-Friesland → Sneek 1921
wegwijzerdementie.nlNetwerk Dementie NHNWegwijzerdementie provides information and an overview of support and care for people with dementia and their families in the regions of Kop van Noord-Holland, West-Friesland, and Regio Alkmaar, North Holland North.Palliative & End-Of-Life Care → Elderly Care 1061 Neurology → Dementia 509 dementia 674 home care 827 region 5412 network 11123 care 12338 De Fryske Marren → Lemmer 1188
dehegefonnen.nlSCC De Hege FonnenThe Hege Fonnen – Sport- and Cultural Center Lemmer is a municipal center that offers sports halls, cultural facilities and catering services.Garden → Swimming Pools 601 Sport Facility → Sports Centers 439 hall rental 124 sports hall 270 theater 2544 catering 6456 municipality 6837 association 8562 De Fryske Marren → Lemmer 1188
depreamkeskouwers.nlSchaatsclub de PreamkeskouwersSchaatsclub de Preamkeskouwers is a speed skating club located in Friesland, offering training, events, and activities for various age groups and skill levels.Ice Rinks → Ice Skating Clubs 218 skating 314 youth 3126 member 10154 training 28133 event 45199 De Fryske Marren → Lemmer 1188
schaapbron.nlSchaap & BronSchaap & Bron is a VAG specialist offering car dismantling, maintenance, and repair services.Tires → Tire Retailers 182 automaterials 14 mot 806 part 5044 repair 14576 De Fryske Marren → Joure 689
breimersbakkerij.nlConsumenten webshopThe website of Breimer's Bakkerij is an online shop where customers can order bread, rolls, pastries, cakes, cookies, chocolate and candies. The webshop also provides information about locations and offers a delivery service.Pastry → Cakes 826 Supermarkets & Grocery → Food Stores 1058 delivery service 236 bakery 718 shop 6483 order 6912 assortment 7799 De Fryske Marren → Lemmer 1188
pv-flevoland.nlPostduivenvereniging FlevolandThe website of the Postduivenvereniging Flevoland provides information about the association, its activities and members. It serves as a platform to promote pigeon racing in Flevoland and inform its members.Pigeon Racing → Breeding 14 championship 210 pigeon 284 association 8562 member 10154 event 45199 Noordoostpolder → Nagele 79
gaasterlan-natuerlan.nlStichting Gaasterlân NatuerlânThe website of Stichting Gaasterlân Natuerlân provides information about the protection and preservation of nature and landscapes within the municipality of De Fryske Marren, specifically in the region of Gaasterlân.Nature → Nature Organizations 104 preservation 76 landscape 2609 municipality 6837 nature 9094 collaboration 16036 De Fryske Marren → Mirns 22
dierenartsenpraktijkgaasterland.nlDierenartsenpraktijk Gaasterland B.V.Dierenartsenpraktijk Gaasterland is a veterinary practice offering care for a variety of animal species.Primary Care → Veterinary Medicine 704 veterinary practice 71 companion animals 83 animal 2908 horse 4337 De Fryske Marren → Balk 224
vvg-deschakel.nlCongregation of Believers in EchtenerbrugThe website of the Congregation of Believers in Echtenerbrug provides information about their services, such as worship services, prayer meetings, and Bible studies, as well as details about their faith and activities.Protestant Churches → Evangelical 552 Protestantism → Baptist 245 worship service 10 prayer meeting 11 kidsclub 33 bible study 54 sunday 208 community 7931 De Fryske Marren → Echtenerbrug 24
trekzakclubjoure.nlTrekzakclub van JoureThe website of the Trekzakclub of Joure presents the club, its activities, and agenda.Performing Arts → Music Groups 100 accordion 165 club 4225 atmosphere 5591 member 10154 music 13170 De Fryske Marren → Joure 689
trekzakver-westfriesland.nlTrekzakvereniging West-FrieslandThe website of the Trekzakvereniging West-Friesland provides information about the association, its activities such as lessons and performances, and the opportunity to become a member.Traditional → Traditional Music 20 Associations & Societies → Music Associations 1003 orchestra 1315 lesson 5154 association 8562 De Fryske Marren → Lemmer 1188
tegengastjeukemeer.nlStichting Tegengas TjeukemeerThe website of Stichting Tegengas Tjeukemeer provides information and updates regarding the organization's concerns about the proposed gas extraction project FFW in Friesland, and the subsequent legal proceedings.Nature → Environmental Management 529 Nature → Environmental Protection 120 gas extraction 26 legal proceedings 31 permit 744 foundation 6678 news 15293 De Fryske Marren → Delfstrahuizen 47
sloepweesje.nlStichting SloepweesjeThe website of the Sloeproeivereniging "Het Sloepweesje" from Hoogmade serves as an information center for the association, its teams, events, and history.Water Sports → Rowing 303 sloop 272 sponsorship 2686 foundation 6678 history 7286 event 45199 Schouwen-Duiveland → Bruinisse 214
kamstra-travel.nlKamstra TravelKamstra Travel is a travel agency specializing in tours to Holland and Belgium, offering a variety of group travel packages.Europe → Belgium 260 Planning → Tours 870 holland 39 belgium 75 group travel 84 tours 1048 tour 2315 news 15293 De Fryske Marren → Lemmer 1188
werkenbijijbgroep.nlIJB GroepIJB Groep is a specialist and market leader in foundation technology, providing a complete solution for foundation projects.Construction Technology → Foundation Technology 135 Business → Industry 36977 academy 593 concept 3338 vacancy 6598 foundation 6678 sustainability 18451 Noordoostpolder → Emmeloord 1649
schaatstochten.nlschaatstochten.nlSchaatstochten.nl is a website providing information about ice skating tours in the Netherlands. The website offers an overview of current tours, including details about dates, locations, and registration.Winter Sports → Skating 841 skating 314 tour 2315 registration 4366 news 15293 Southwest-Friesland → Hemelum 36
reuringhoorn.nlStrandpaviljoen ReuringStrandpaviljoen Reuring is a seaside pavilion in Hoorn, Netherlands, offering visitors a summer experience with food, drinks, and events.Beach → Beach Pavilions 162 Event & Party Venues → Beach Restaurants 210 summer 483 takeaway 653 snack 2916 beach 3210 event 45199 De Fryske Marren → Lemmer 1188
wumkesskoalle-meilan.nlWumkesskoalleThe website of Wumkesskoalle presents the school and its pedagogical approach, focusing on helping children discover themselves and providing a safe and stimulating environment for their growth.Elementary Schools → Christian Primary Schools 342 Childcare → After-School Care 765 schoolyard 77 pedagogy 402 parent 4318 school 7856 Friesland → Heerenveen 2578
beautyunit.nlBeautyUnit LemmerThe BeautyUnit in Lemmer is a beauty salon, hair salon, and nail salon focused on improving customers’ appearance through skin improvement, hair styling, nail styling, and makeup services.Beauty → Makeup 1248 appearance 248 skin improvement 1058 makeup 1477 nails 1719 hair 3014 salon 5541 De Fryske Marren → Lemmer 1188
roeloffzen.nlRoeloffzen VastgoedRoeloffzen Vastgoed is a real estate partner offering rental, sales, management, and brokerage services for commercial real estate.Rental Properties → Renting 386 Commercial Property → Commercial Housing 37 real estate management 123 business space 130 brokerage 433 real estate 4981 rental 7257 De Fryske Marren → Lemmer 1188
opgroeieninsmallingerland.nlWegwijzers SmallingerlandThe website 'Opgroeien in Smallingerland' provides information and activities for parents, caregivers, and children aged 0 to 18 years in the municipality of Smallingerland, focusing on the healthy development and support of children.Personal Stories → Autobiography 222 childhood 56 municipality 6837 child 11566 collaboration 16036 De Fryske Marren → Oudemirdum 73
recoveryrun.nlRCVRY RUNRecovery RUN offers sports and movement programs for oncology patients, focused on physical, mental, and social well-being.Body & Movement → Exercise 1005 Sports → Group Class 2051 cancer 631 trainer 1966 wellbeing 2620 patient 4082 sport 4228 Buren → Lienden 238
werkenbijvreeker.nlVreeker B.V.This website, operated by Vreeker B.V., lists job vacancies, internships, and part-time positions without the use of employment agencies, with a focus on the West-Friesland region in North Holland, specifically in the municipalities of Hem and Hoorn.Garden Maintenance → Garden Landscaping 711 Local Economy & Development → Regional Economy 171 water technology 44 gardener 299 cemetery 395 vacancy 6598 De Fryske Marren → Lemmer 1188
steampoint-meilan.nlCBO MeilânThe website of Steampoint offers a maker lab where children from groups 1 to 8 learn about technology and undertake design projects.Technology & IT → Educational Innovation 225 Technology → Robotics & Automation 860 robot 423 research 8967 workshop 19325 design 27202 De Fryske Marren → Oudehaske 49
dirkbreed.nlStichting Uitgeverij Noord-HollandThe website is dedicated to the artist Dirk Breed and his work.Tourism → Cultural Attractions 698 Painting → Dutch Art 322 north holland 138 artworks 460 artist 5745 foundation 6678 book 11396 De Ronde Venen → Waverveen 58
dapnoordwestfriesland.nlD.A.P NOORD WEST FRIESLANDD.A.P NOORD WEST FRIESLAND is a veterinary practice offering a wide range of services for companion animals, livestock animals, and horses.Primary Care → Veterinary Medicine 704 Agriculture → Livestock 2413 castration 14 vaccination 494 veterinarian 864 diagnosis 1490 animal 2908 treatment 21203 De Fryske Marren → Lemmer 1188
eenorigineledag.nlEenorigineledag.nlThis website offers an overview of outings for bachelor/bachelorette parties, company outings, family outings, and group outings in the Netherlands and Belgium.Family Activities → Outings 763 Activities → Group Outings 133 bachelor party 113 group outing 149 company outing 166 outing 982 region 5412 The Hague → Loosduinen 395
stichtingbasbacker.nlStichting Jonkvrouwe J.E.J. Bas BackerThe website of Stichting Jonkvrouwe J.E.J. Bas Backer provides information about the foundation, its objectives, and how to apply for financial contributions.Legal → Government Affairs 42 application 3377 donation 5110 region 5412 event 45199 Southwest-Friesland → Hindeloopen 127
sinninart.nlSinnin ArtThe website of Sinnin Art showcases the artwork of visual artist Marieke de Jong, who creates bronze sculptures, epoxy art, and paintings, often inspired by the Dutch landscape and with a focus on movement and humor.Visual Arts → Sculptors 203 Visual Arts → Abstract Sculpture 13 epoxy 162 bronze 225 sculpture 1440 gallery 1983 artwork 2248 paintings 3907 Heerenveen → Akkrum 246
mshydra.nlMS HydraMS Hydra is a unique group accommodation and sightseeing boat located in Sneek, Friesland, offering overnight stays, sightseeing tours, and events.Water Travel → Boat Tours 640 Accommodation → Boats 12 sightseeing tour 17 crew 320 accommodation 4921 ship 5103 event 45199 De Fryske Marren → Goingarijp 86
sloepfriesland.nlSloopfrieslandThe website of Sloepfriesland offers canal tours and boat rental services in the area of Sneek on the Friesian lakes.Water Recreation → Canal Tours 106 Vacations → Water Travel 978 friesian lakes 12 canal tour 99 boat 2980 Southwest-Friesland → Sneek 1921
voedselbanklemsterland.nlStichting Voedselbank LemsterlandThe Voedselbank Lemsterland is a foundation that collects and distributes food to individuals in need in Lemmer and surrounding areas.Volunteering → Food Banks 184 Social Services → Welfare 1001 food bank 216 privacy 1286 food 3872 report 4551 foundation 6678 volunteer 8367 's-Hertogenbosch → Empel 51
trekkertrekoudemirdum.nlStichting Trekkertrek OudemirdumThe website of Trekkertrek Oudemirdum informs visitors about the annual tractor pull competition, including registration, regulations, participant classes, sponsors, and results from previous years.Sports & Auto → Agricultural Events 118 tractor pull 61 regulation 1350 participant 1934 sponsors 2642 results 3954 registration 4366 De Fryske Marren → Oudemirdum 73
provier.nlProvier VastgoedadviseursThe website of Provier Vastgoedadviseurs offers an overview of available real estate properties for sale and rent in Northern Netherlands and provides real estate consulting, management, and appraisal services to both private and institutional investors.Property Finance → Purchase 493 Property Technology & Data → Real Estate Research 20 brokerage 433 appraisal 1488 consulting 3639 real estate 4981 portfolio 6854 Southwest-Friesland → Bolsward 566
bureauinfocus.nlBureau IN FOCUSBureau IN FOCUS is a specialist providing certification services for VCA, VCU, and ISO standards.Specialty Medicine → Occupational Medicine 1291 arbowet 28 compliance 506 risk 2896 certification 3380 safety 5819 De Fryske Marren → Lemmer 1188
edwinpietersma.nlEdwin Pietersma Training & AdviesThe website of Edwin Pietersma Training & Advies offers a range of EHBO (First Aid), BHV (Fire Safety), Reanimation and AED courses, aimed at educating individuals and companies to respond adequately to emergencies.Prevention → First Aid 1070 Safety → Fire Safety 1048 risk assessment 133 certification 3380 course 14728 training 28133 Steenwijkerland → Giethoorn 565
tighbarra.nlTigh BarraTigh Barra is an Irish pub and pop venue located in Joure that offers a selection of Irish beers, whiskeys, live music, and events.Pubs → Irish Pubs 11 Performance → Live Music 1612 whiskey 78 pub 185 beer 2887 terrace 4847 music 13170 De Fryske Marren → Joure 689
joure-touristinformation.nlJoure, Langweer and Terherne Tourist InformationThis website provides tourist information for the municipalities of Joure, Langweer, and Terherne in Friesland, Netherlands.Tourism → Regional Tourism 242 tourism 303 boat 2980 accommodation 4921 shop 6483 De Fryske Marren → Terherne 98
rvsaccuraat.nlRVS AccuraatRVS Accuraat is a company that delivers custom RVS kitchens and interior solutions, focusing on craftsmanship and precision.Hospitality → Kitchen Equipment 315 Finishing & Trades → Interior Construction 502 interior solution 16 design 27202 De Fryske Marren → Lemmer 1188
heddema.nlMakelaardij HeddemaThe website of Makelaardij Heddema showcases the services of a real estate agency, specializing in the sale, purchase, and valuation of homes and recreational homes in the Friesland region, with a particular focus on the Frisian lakes.Property Sales → Buying a House 872 Property Agents & Brokers → Realtors 341 recreational home 67 broker 902 purchase 2212 valuation 2697 sale 5930 home 7976
martindeboer.nlGlashandel Martin de BoerGlashandel Martin de Boer Leeuwarden is a glass dealer with a wide stock and specialized services, specializing in glass processing and stained glass.Building & Materials → Glass 697 Home → Glassworkers 87 stained glass 317 glass 2919 interior 8093 installation 13742 Northeast-Friesland → Dokkum 846
bobkeukenbouwer.nlBob KeukenbouwerBob Keukenbouwer is a kitchen specialist located in Joure, Friesland, offering new kitchen design, renovation, and sales of kitchen equipment and accessories.Kitchen → Kitchen Renovation 260 Kitchen → Kitchen Design 443 kitchen blade 18 kitchen renovation 24 kitchen equipment 98 showroom 4883 kitchen 6443 De Fryske Marren → Joure 689
lisannespaander.nlLisanne SpaanderThe website of Lisanne Spaander showcases her work as a singer-songwriter, vocalist, and speaker, offering the option to book her for events, take singing lessons, and find inspiration.Popular → Singer-Songwriter 262 Event Planning → Artist Booking 69 singing lessons 243 speaker 1481 inspiration 4081 performance 7586 story 8285 music 13170 De Fryske Marren → Lemmer 1188
dewitstukadoors.nlDe Wit StukadoorsDe Wit Stukadoors is a stucco specialist with a long tradition, providing services to homeowners and businesses in West-Friesland and the Randstad.Construction Companies → Plasterers 843 Plastering & Rendering → Stucco 210 spachtelputz 28 stucco 119 mold 356 ceiling 627 plaster 2175 Drechterland → Oosterwijzend 177
hayfever.nlHayfeverThe website of Hayfever, a Dutch cover band, showcases their repertoire, schedule, and booking options.Rock → Dutch Rock 54 Live Music → Cover Bands 433 rocknroll 15 repertoire 2497 schedule 2624 band 2977 music 13170 event 45199 Achtkarspelen → Harkema 113
blooming.nlBloomingBlooming is a specialist in creative floral design and interior objects, focusing on events, product promotion, and stand design.Flowers → Florists 1410 Events → Event Styling & Decoration 1360 event styling 21 floral design 48 flowers 3248 interior 8093 De Fryske Marren → Lemmer 1188
boskengreide.nlBosk & GreideBosk & Greide is an association focused on agricultural and private nature and landscape management in the Gaasterland area.Landscape → Regional Landscapes 18 Government & Administration → Government Organizations 1002 agriculture 778 landscape 2609 nature 9094 De Fryske Marren → Nijemirdum 19
beachvolleybaloudemirdum.nlStichting Beachvolleybal OudemirdumThe website of Stichting Beachvolleybal Oudemirdum presents the schedule and information for various beach volleyball tournaments, including a main tournament and a youth tournament.Golf → Tournaments 454 Youth Development → Youth 1033 tournament 2476 schedule 2624 youth 3126 match 3471 De Fryske Marren → Oudemirdum 73
oranjeverenigingnootdorp.nlOranjevereniging NootdorpThe website of Oranjevereniging Nootdorp (OVN) provides information about the association, its activities, events, and history. It serves as a central source of information for members and visitors to Nootdorp.Associations → Village Associations 152 Festivals → Carnival 1150 kermis 52 association 8562 event 45199 Goeree-Overflakkee → Achthuizen 44
wijkraadoekenvoorstondenbroek.nlVereniging Wijkraad Oeken-Voorstonden-BroekThe website of the Oeken-Voorstonden-Broek Neighborhood Council serves as a communication channel between the municipality and residents, and facilitates the shaping of neighborhood policy and projects.Local Government → Neighborhood Councils 150 Neighborhood Focus → Neighborhood Organizations 1593 neighborhood council 80 wishes 2717 resident 3245 municipality 6837 communication 10162 De Fryske Marren → Broek 21
zeilschoolkampioenschappen.nlStichting Zeilschool KampioenschappenThe website describes the Zeilschool Kampioenschappen, an annual event organized by a foundation.Running → Races 266 Events & Activities → Outdoor Activities 1043 sailing school 39 race 1043 participant 1934 foundation 6678 event 45199 Southwest-Friesland → Heeg 227
fysiolemsterpark.nlFysio LemsterparkThe website of Fysio Lemsterpark offers physiotherapy treatments and guidance to patients with various complaints and conditions.Patient Services & Rights → Patients 45 result 1902 patient 4082 physiotherapy 4688 therapy 7448 practice 9089 De Fryske Marren → Lemmer 1188
kostenboekhouder.nlOnbekendThis website provides a directory of bookkeepers located in various regions of the Netherlands.Business Software → Accounting Software 984 Taxation → VAT 266 income tax 61 bookkeeper 80 vat 432 administration 6587 price 8328 Midden-Groningen → Slochteren 137
tfwf.nlTruckfestival West-FrieslandThe website of the Truckfestival West-Friesland provides information about this annual festival held in Medemblik, where over 100 trucks are displayed.Cars → Classic Cars 1145 outing 982 truck 1412 sponsors 2642 festival 3804 De Fryske Marren → Lemmer 1188
blinkadmin.nlBlinkThe website of Blink describes a financial advisory firm offering administrative services, tax advice, and collaborative partnership to businesses and individuals.Business Support & Advisory → Advisory 413 annual account 399 tax 2100 administration 6587 collaboration 16036 De Fryske Marren → Joure 689
opmeerderdagblad.nlOpmeerderdagblad.nlOpmeerderdagblad.nl is a news website that provides the latest news and special topics from the Opmeer region, West-Friesland, and surrounding areas.Events → Places 1219 Culinary & Tastings → Wine Events 13 festival 3804 municipality 6837 clothing 9443 news 15293 event 45199 De Fryske Marren → Lemmer 1188
bouwbedrijfvandijk.nlBouwbedrijf Van DijkBouwbedrijf Van Dijk is a construction company with a long tradition (since 1886) providing new construction, renovation, maintenance, and restoration services to homeowners and businesses in the regions of Overijssel, Drenthe, and Southwest Friesland.Construction Companies → Construction Contractors 536 Building & Materials → Carpentry & Joinery 830 construction company 824 new construction 2672 restoration 3417 renovation 13849 sustainability 18451 maintenance 20093 De Fryske Marren → Balk 224
zoekhiereendier.nlZoekhiereendier.nlThe website zoekhiereendier.nl offers a guide on animal welfare, home & garden, and natural remedies, also offering business services.Societal Change → Social Movements 114 Politics → Activism 237 natural remedies 13 housing crisis 24 handbag 82 animal welfare 174 event 45199 De Fryske Marren → Lemmer 1188
recreatieparkburghorn.nlRecreatiepark BurghornRecreatiepark Burghorn is a recreation park in West-Friesland that offers facilities such as a swimming pool, playground, and animation.Garden → Swimming Pools 601 Camping → Campsites Netherlands 792 playground 1088 swimming pool 1664 animation 1777 park 1863 camp 2466 beach 3210 De Fryske Marren → Lemmer 1188
novtouring.nlNOV Touring B.V.NOV Touring B.V. provides group transportation, maintenance, repair, and support for the NOV Museum.Bus Services → Public Transportation 782 Visual Arts → Museums 2049 bus 894 museum 2002 transportation 2851 catering 6456 shop 6483 maintenance 20093
whatsthemetta.nlWhat’s the MettaThe What’s the Metta website offers empathetic and professional support in the form of Mindfulness-based courses and personal development processes, utilizing principles from positive psychology.Resources → Books 3936 Mental & Emotional Well-Being → Healthy Living 402 workbook 154 exercise 706 mindfulness 1789 course 14728 De Fryske Marren → Balk 224
projectdirect.nlProject DirectProject Direct webdesign is a web design agency that helps businesses create websites and webshops.Online Marketing → Sea 459 E-Commerce → Webshop Development 950 hosting 3125 seo 3707 webshop 8648 De Fryske Marren → Lemmer 1188
wiardakeukens.nlWiarda KeukensWiarda Keukens is a family-owned business in Echtenerbrug, Friesland, that sells and installs kitchens, bathrooms, and tiles.Kitchen → Kitchen Suppliers 437 tile 2869 bathroom 3784 kitchen 6443 design 27202 De Fryske Marren → Echtenerbrug 24
timmerfabriekdijemago.nlTimmerfabriek DijemagoTimmerfabriek Dijemago is a timber factory in Friesland that manufactures custom-made hardwood frames, doors, and staircases.Construction & Renovation → Staircases 329 Windows → Frames 1211 staircase 454 customization 1723 door 2210 frames 2556 wood 4153 warranty 4701 De Fryske Marren → Sint Nicolaasga 146
baptistenlemmer.nlBaptistengemeente LemmerThe website of the Baptistengemeente Lemmer provides information about the church, its services, its beliefs, and its activities for various age groups, including foreign visitors and the deaf.Protestantism → Reformed 1323 Protestantism → Baptist 245 church service 879 mission 1000 translation 1523 church 3439 registration 4366 De Fryske Marren → Lemmer 1188
studio2be.nlStudio2BeThe website presents Studio 2BE, a studio that offers band and theater rehearsals, recordings, and performances, with facilities such as a sound system and a chill room.Recordings & Production → Recording Studios 473 Industry → Industrial 1987 backline 22 rehearsal space 46 sound system 166 parking space 294 studio 5465 De Fryske Marren → Lemmer 1188
wiebzandberg.nlMakelaardij Wieb ZandbergMakelaardij Wieb Zandberg is a real estate agency specializing in the sale, purchase, and valuation of properties in the Friesland region.Property Valuation & Appraisal → Residential Appraisal 622 Property Agents & Brokers → NVM Real Estate Agents 105 appraisal 1488 purchase 2212 real estate 4981 sale 5930 Heerenveen → Akkrum 246
vogelwachtjoure.nlVogelwacht Joure e.o.Vogelwacht Joure e.o. is a nature-loving association dedicated to bird protection and conservation.Nature → Nature Organizations 104 Environment → Conservation 328 protection 728 bird 922 monitor 1063 photo 7778 association 8562 nature 9094 De Fryske Marren → Joure 689
haskerfjild-meilan.nlIt HaskerfjildThe website of It Haskerfjild, part of CBO Meilan, presents the school, its objectives, facilities, and offerings to prospective students and parents.Elementary Schools → Christian Primary Schools 342 Government & Administration → Local Municipalities 219 parent 4318 student 7623 school 7856 education 13471 De Fryske Marren → Joure 689
dekastinconcert.nlDe KastThis website provides information about the 30th anniversary show of the Frisian pop group De Kast, taking place on December 14, 2023, at the AFAS Live in Amsterdam.Rock → Dutch Rock 54 Folk Music → Irish Music 12 fan 298 cd 574 concert 4409 De Fryske Marren → Lemmer 1188
kerkzuidbroek.nlPetruskerk & Stichting Oude Groninger KerkenThe website of the Petruskerk in Zuidbroek provides information about the history, architecture, interior, and surroundings of the church, as well as an agenda of organized activities and the possibility to donate.Protestantism → Churches 1009 Architecture → Religious Buildings 15 tower 188 sculpture 1440 church 3439 paintings 3907 De Fryske Marren → Broek 21
autorijschoolvoorautisme.nlRijschool voor Autisme | Marco van TolThe website of Rijschool voor Autisme | Marco van Tol offers driving lessons in Hoorn and the surrounding area, specializing in lessons for individuals with autism, ADHD, and exam anxiety, and also offering lessons with an automatic transmission.Mental & Emotional Well-Being → Autism 958 driving instructor 252 mirror 371 autism 758 driving lessons 2453 car 10865 De Fryske Marren → Lemmer 1188
bosmanautischeservices.nlBosma Nautische ServicesBosma Nautische Services is a company specializing in the maintenance and repair of sailing yachts, and offering associated services, including marina facilities.Maritime → Shipbuilding 568 Water → Boats 935 teakdeck 17 sailing yacht 58 marina 487 engine 758 equipment 4143 De Fryske Marren → Lemmer 1188
karinavanlent.nlKarina van LentThe website of Karina van Lent showcases the work of a visual artist specializing in art made from cardboard, and offers painting and drawing lessons.Painting → Contemporary Art 805 Arts & Culture → Art Lessons 10 cardboard 170 journey 701 artwork 2248 lesson 5154 studio 5465 nature 9094 De Fryske Marren → Balk 224
opdriftwatersport.nlThe Watersport Winkel van LemmerThe Watersport Winkel van Lemmer is a webshop and physical store that sells watersport equipment, beach supplies, and accessories.Water Sports → Watersports Equipment 13 watersport 540 adventure 919 parking 1928 store 3901 De Fryske Marren → Lemmer 1188
boerewille.nlZorgboerderij BoerewilleZorgboerderij Boerewille offers day care services to adults with mild to moderate intellectual or psychiatric disabilities.Farms & Farm Businesses → Care Farms 473 care farm 246 daycare 1365 participant 1934 farm 2622 De Fryske Marren → Sint Nicolaasga 146
debroek.nlWatersportbedrijf De BroekWatersportbedrijf De Broek is a watersport rental company located in Broek, Friesland, offering boat rentals.Boating → Marinas 825 motorboat 128 boat 2980 De Fryske Marren → Lemmer 1188
grootslag600.nlCommandeur MediaThe website serves as an official information source about the 600-year-old polder Het Grootslag, including events and its history.Historical Sites → Windmills 100 Walking → Walking Events 137 polder 476 food 3872 region 5412 history 7286 book 11396 event 45199 De Fryske Marren → Lemmer 1188
zo-in-balans.nlZo in balans coachingThe website of Zo in balans coaching offers guidance to women struggling with unhealthy eating habits and a negative relationship with their body, aiming to promote a relaxed and self-care focused approach to food and body image.Personal Growth → Behavior Change 173 Mental & Emotional Well-Being → Eating Disorders 199 need 469 body 3490 food 3872 relationship 4205 health 6366 coach 25810 De Fryske Marren → Lemmer 1188
toeristenkerkonderdijk.nlToeristenkerk OnderdijkThe website of the Toeristenkerk Onderdijk provides information about the services, programs, and events held at the church, aimed at visitors from the surrounding area and tourists.Travel → Tourism 3754 visitors 1048 church 3439 coffee 3838 music 13170 event 45199 De Fryske Marren → Lemmer 1188
dutchopengrasstrack.nlDutch Open Grass TrackThe website of the Dutch Open Grass Track provides information about competitions, events, and news related to this competition.Chess → Chess Clubs 261 Motor → Motorsport 1438 competition 4759 news 15293 event 45199 De Fryske Marren → Joure 689
culihoppen.nlC & C FactoryThe Culihoppen website offers a platform for culinary tours and activities in various regions of the Netherlands, including Elburg, Elspeet, Ermelo, Harderwijk, Lemmer, the Veluwe, Vierhouten and Zwolle. The website also includes a blog with recipes and news.Food → Culinary Travel 43 Planning → Tours 870 tours 1048 ticket 2785 recipe 5142 restaurant 11215 blog 13392 news 15293 De Fryske Marren → Lemmer 1188
kinderboekendag.nlTerherne kinderboekendagThe Kinderboekendag Terherne website provides information about the annual Kinderboekendag, which has been organized since 2000 and focuses on offering a free day of adventure and books for children and their parents.Youth Organizations → Scouting 1004 Family Fun → Children’s Activities 1906 adventure 919 book 11396 De Fryske Marren → Terherne 98
muziektheater-langweer.nlMuziektheater LangweerMuziektheater Langweer presents the open-air theater piece Alice in Bangweer.Theater → Outdoor Theater 71 Music & Performance → Music Events 758 fairy tale 67 director 716 village 808 theater 2544 performance 7586 Southwest-Friesland → Molkwerum 30
stiawf.nlStichting Archeologie West-FrieslandThe Stichting Archeologie West-Friesland is dedicated to supporting and promoting archaeology in West-Friesland, and increasing public awareness of archeology and cultural history in the region.Museums & Collections → Archaeology 291 Government & Administration → Government Organizations 1002 cultural history 33 west-friesland 41 anbi 120 archaeology 256 board 3438 De Fryske Marren → Lemmer 1188
jaarmarktnibbixwoud.nlNibbixwoudThe website of the Nibbixwoud Annual Fair presents information about the annual fair held in Nibbixwoud, including details about the date, times, activities, and vendor information.Local Events → Fairs 707 fire department 171 fair 583 entertainment 1165 association 8562 De Fryske Marren → Lemmer 1188
verloskundigepraktijkrunom.nlVerloskundige Praktijk RûnomThe website of Verloskundige Praktijk Rûnom provides information about obstetrical care, pregnancy, childbirth, and postpartum care, as well as contact details and locations.Pregnancy & Childbirth → Obstetrics 240 lactation 10 obstetrics 33 postpartum 464 ultrasound 769 childbirth 894 pregnancy 2739 Southwest-Friesland → Koudum 134
pknearnewald.nlPKN Gemeente EarnewâldThe website of the PKN (Philippine Korean Network) church in Earnewâld provides information about the church services, activities, history, and contact details of the community.Catholic → Parishes 457 Local Communities → Villages 1005 church bulletin 23 church council 34 church service 879 history 7286 collection 7566 Northeast-Friesland → Ia 40
aartveldhuizen.nlAart VeldhuizenThe website of Aart Veldhuizen offers spiritual guidance and reflections, including columns, sermons, and articles, and information about his work as a preacher and spiritual caregiver.Christianity → Theology 305 Social Issues & Welfare → Social Issues 18544 preacher 150 column 543 work 3122 podcast 3328 article 6000 Southwest-Friesland → Sneek 1921
mxhotshots.nlMXHotShotsThe website provides an overview of various motorsport events, primarily cross-country races and training sessions.Motor → Motorsport 1438 dmx 12 cross 88 race 1043 category 2316 training 28133 Noordoostpolder → Rutten 62
koninklijkepeijnenburg.nlKoninklijke PeijnenburgThe website of Koninklijke Peijnenburg presents job vacancies for various locations.Food & Beverage → Food Industry 835 employer 2383 employee 4429 vacancy 6598 Altena → Nieuwendijk 123
azov.nlAZOV MusicalsThe website of AZOV Musicals presents information about the musical productions of the amateur musical association, with special emphasis on the performance of ‘Charlie and the Chocolate Factory’ in October 2025, ticket sales, and opportunities to register for the waiting list.Associations & Societies → Music Societies 228 Theater → Musical 292 musical 510 orchestra 1315 ticket 2785 production 4582 performance 7586 association 8562 De Fryske Marren → Lemmer 1188
cesareinterieuratelier.nlCESAREThe website of CESARE is an interior atelier specializing in the design and construction of interiors for hospitality businesses, including restaurants, cafes, hotels, and other companies in the hospitality industry. It showcases a portfolio of projects and offers services for interior design and construction.Hospitality → Kitchen Equipment 315 hospitality 3491 hotel 3543 construction 7421 interior 8093 restaurant 11215 design 27202 Aa en Hunze → Rolde 176
musicalopmeer.nlMusicalvereniging Z&VThis website provides information about Musicalvereniging Z&V's musical productions, including upcoming shows and recruitment efforts.Associations & Societies → Music Societies 228 Theater → Musical 292 musical 510 production 4582 family 6462 association 8562 member 10154 De Fryske Marren → Lemmer 1188
hoekstra-idskenhuizen.nlHoekstra Idskenhuizen BVHoekstra Idskenhuizen BV is a company specializing in the transport and storage of various goods.Transportation Services → Freight Transport 378 Logistics → Storage 1170 walkingfloor 13 storage 2446 transportation 2851 vehicle 3743 sustainability 18451 De Fryske Marren → Idskenhuizen 12
oudjoure.nlN.V.The website Oud Joure presents the history, culture, and traditions of the village of Joure, with a focus on the Vlecke and the Old Land and Waterways.Social Sciences → Folklore & Mythology 43 Traditional Practices → Folklore 121 folklore 19 tradition 736 Katwijk → Katwijk aan Zee 616
sintinwestfriesland.nlSint in West-FrieslandThe website of ‘Sint in West-Friesland’ is an informative and promotional page for the annual arrival of Saint Nicholas in the West-Friesland region, including details about the processions in various villages and the organization of the ‘Club of Saint Nicholas’ and ‘Friends of Saint Nicholas’.Holidays → Saint Nicholas 35 Context 161394 saint nicholas 25 procession 82 De Fryske Marren → Lemmer 1188
eh6.nlN.v.v. De ZwaardklampThis website describes the history and current status of the EH6, a former milk transporter that was later used as a fisherman and sailing yacht.Local History → Dutch History 1067 Museums & Collections → Historic Ships 26 cabin 351 ship 5103 De Fryske Marren → Lemmer 1188
westfrisianoutlawz.nlWest Frisian OutlawzThe West Frisian Outlawz website provides information about the American football club, its history, events, team, and sponsors.Football → Hall Football 62 american football 13 sponsors 2642 match 3471 club 4225 De Fryske Marren → Lemmer 1188
andrevanduintweewielers.nlAndre Van Duin TweewielersAndre Van Duin Tweewielers is a bicycle shop specializing in providing advice, repair, maintenance, rental, and the sale of new and used bicycles.Bicycles → Two-Wheelers 238 e-bike 908 bicycle 2838 rental 7257 repair 14576 brand 17737 De Fryske Marren → Lemmer 1188
mannenuitjes.nlMannen Uitjes BVThe website offers outings and activities, primarily geared towards men, such as bachelor parties, team outings, and weekend trips.Travel Agencies → Group Travel 207 Activities → Excursions 257 simulator 180 excursion 662 motorcycle 2110 Raalte → Luttenberg 532
kokomolifestyle.nlSomar WebdesignKOKOMO Lifestyle is a home and lifestyle shop located in Workum, Friesland, offering fashion and home decor items.Upholstery & Fabrics → Cushions 245 Household & Cleaning → Household Goods 1642 online order 71 cushion 823 fashion 2212 shop 6483 interior 8093 Southwest-Friesland → Workum 363
notarispaauwe.nlNotariskantoor PaauweNotariskantoor Paauwe, located in Workum, Zuid West Friesland, provides comprehensive information about notarial affairs and personal legal services, including the purchase and sale of real estate, gifts, wills, and business law.Law → Business Law 1361 Legal → Notaries 848 cohabitation agreement 44 agricultural 142 notary 791 real estate 4981 gift 6442 De Fryske Marren → Lemmer 1188
akkermanhoveniers.nlAkkerman HoveniersThe website of Akkerman Hoveniers presents the services of the landscaping company, specializing in garden design and maintenance, with a focus on project examples and a company history overview.Garden → Paving 1003 Landscaping → Garden Installation 617 tree care 245 woodwork 387 garden maintenance 462 garden design 964 paving 1942 Southwest-Friesland → Hindeloopen 127
despecerij.nlRestaurant De SpecerijThe website of Restaurant De Specerij presents the restaurant, offers a menu, booking options, and information about catering and contact details.AccommodationTypes → Accommodation 12130 atmosphere 5591 dish 5936 catering 6456 restaurant 11215 book 11396 menu 13856 De Fryske Marren → Lemmer 1188
kerstboom-flevoland.nlThom NeefjesThe website offers an online service for ordering and delivering Christmas trees in West-Friesland and Flevoland, with various sizes and prices.Christmas → Christmas Decorations 147 Food Delivery → Delivery 2227 nordmann 53 christmas tree 322 landscaping 1529 De Fryske Marren → Lemmer 1188
fotogroepinfocus.nlFotogroep InFocus ZuidhornThe Fotogroep InFocus Zuidhorn website showcases their photo assignments and exhibitions from seasons 21-24, including themes such as ‘Splashing Goodbye!’ and ‘The Suikerbiet(en) Campaign’. The aim is to share and promote their photographic work.Planning → Tours 870 Activities → Excursions 257 excursion 662 assignment 1121 theme 4015 exhibition 5332 photography 9503 De Fryske Marren → Joure 689
knapwurk.nlKnapwurk Reclame BurgumThe website of Knapwurk Reclame Burgum provides advertising and lettering services, focusing on light advertising, car and window lettering, and various materials such as stainless steel, plastic and LED.Advertising → Lettering 569 Design → Typography 203 advertising column 34 stainless steel 737 letter 834 advertising 2302 logo 4660 print 5511 Tytsjerksteradiel → Burgum 371
westfrieslandleert.nlCollaborating Schools in West-FrieslandThe West-Friesland Leert website provides information and support to parents of 8th-grade students in West-Friesland who are looking for suitable secondary schools.Personal Development → Guidance 781 Primary & Secondary Schooling → Secondary Education 1639 practical training 20 region 5412 student 7623 school 7856 education 13471 collaboration 16036 De Fryske Marren → Lemmer 1188
ikec-hoorn.nlIKEC de ZevensprongThe website of IKEC de Zevensprong provides information about a center for special and basic education that focuses on the development of children aged 2 to 12, particularly those who require extra support. The website details the organization, offerings, and collaboration with various institutions.Special Needs & Support → Educational Organizations 315 vision 1882 childcare 3512 school 7856 education 13471 collaboration 16036 De Fryske Marren → Lemmer 1188
stedebroecsdagblad.nlXYTO Media B.V.Stedebroecsdagblad.nl is an online news platform providing news and information about the region of Stede Broec, North Holland.Local Politics → Parties 622 sport 4228 municipality 6837 clothing 9443 news 15293 event 45199 De Fryske Marren → Lemmer 1188
drechterlandsdagblad.nlDrechterlandsdagblad B.V.The Drechterlandsdagblad is a regional news website providing updates and information about the Drechterland region.Water Travel → Boat Tours 640 Local News → Municipal Information 86 region 5412 municipality 6837 news 15293 event 45199 De Fryske Marren → Lemmer 1188
festivalweekendhoorn.nlFestivalweekend HoornThe website promotes the Festivalweekend Hoorn, a music festival taking place in August 2025, focused on brand promotion and sponsorship.Sports & Entertainment → Sponsorship 151 Festivals → Music Festivals 1020 vip 79 stage 758 festival 3804 artist 5745 brand 17737 De Fryske Marren → Lemmer 1188
douweboomsmatoernooi.nlCVVOThe website provides information and registration details for the annual Douwe Boomsma Tournament, a soccer tournament for young talents.Team Sports → Volleyball 842 Youth → Soccer 254 soccer 92 tournament 2476 sponsors 2642 registration 4366 event 45199 De Fryske Marren → Lemmer 1188
uitvaartboersma.nlUitvaart BoersmaUitvaart Boersma is a funeral home offering comprehensive funeral services, including all associated services and support.Family → Funeral Services 2084 burial 406 cremation 615 grief 1577 funeral 2477 wishes 2717 De Fryske Marren → Lemmer 1188
wapenvanlangweer.nlWapen van LangweerThe Wapen van Langweer is a café in Langweer offering a casual atmosphere for lunch, drinks, or dinner, and the possibility to organize parties and events.Cafes → Brown Cafés 599 Local Communities → Villages 1005 bar 1216 terrace 4847 restaurant 11215 event 45199 De Fryske Marren → Langweer 93
kulturhusoudehaske.nlKulturhus OudehaskeKulturhus Oudehaske informs visitors about activities taking place within the Kulturhûs and provides information about regular users.Institutions → Cultural Institutions 475 Village Focus → Village Initiatives 137 space 3846 agenda 4374 association 8562 care 12338 De Fryske Marren → Oudehaske 49
vdmeer-mechanisatie.nlVan der Meer Mechanisatie & MachinebouwThe website of Van der Meer Mechanisatie & Machinebouw presents a company specializing in the construction of manure mixers, both standard and custom-made models.Agriculture → Agricultural Technology & Innovation 743 silo 96 mixer 104 steel 1177 De Fryske Marren → Lemmer 1188
bedenbreakfastmedemblik.nlBed & Breakfast MedemblikThe website for Bed and Breakfast Medemblik presents a historic building, Rijksmonument t Coggehuis, offering rooms and facilities in the historic city of Medemblik, inviting guests to enjoy the atmosphere, surroundings, and activities in the region.Nature → Cycling 472 bed and breakfast 305 surroundings 463 room 3411 history 7286 restaurant 11215 De Fryske Marren → Lemmer 1188
covheerenveen.nlOratoriumkoor COV HeerenveenThe website of the Oratoriumkoor COV Heerenveen provides information about the choir, its activities, repertoire, and opportunities to participate.Choir → Oratorio 34 Choir → Dutch Choirs 66 messiah 26 repertoire 2497 choir 3123 concert 4409 collaboration 16036 De Fryske Marren → Sint Nicolaasga 146
huper.nlHuperHuper is an online auction platform that sells beer fusts and soft drinks nearing their expiration date, reducing waste.E-Commerce → Marketplaces 1053 Retail → Consumer Services 82 soft drinks 87 bid 230 auction 561 account 5781 De Fryske Marren → Lemmer 1188
pg-thomas.nlProtestantse Gemeente THOMASThe website of the Protestantse Gemeente THOMAS provides information about the church, its activities, news, services, and contact details.Protestantism → Dutch Protestantism 141 Protestantism → Reformed 1323 diaconate 182 pastor 208 church 3439 news 15293 De Fryske Marren → Lemmer 1188
endurancenoord.nlStichting Endurance Noord-NederlandThe website of Stichting Endurance Noord-Nederland provides information about and organizes endurance competitions in Northern Netherlands.Outdoor → Horse Riding 941 Equestrian → Stables 629 stable 768 route 3425 horse 4337 competition 4759 nature 9094 De Fryske Marren → Oudemirdum 73
makelaardijdraijer.nlChris Draijer Makelaardij B.V.Chris Draijer Makelaardij is a real estate agent and appraiser operating in the Southwest Friesland region, assisting with the purchase and sale of homes and commercial properties.Real Estate → Property Valuation & Appraisal 2123 Real Estate → Regional Agencies 215 commercial property 469 appraisal 1488 purchase 2212 sale 5930 property 7406 house 8121 Southwest-Friesland → Workum 363
visgidswestfriesland.nlVisgid WestfrieslandThe website of Visgid Westfriesland provides information about the fishing activities of Tinus in the area around Andijk, Westfriesland, primarily focused on predatory fishing and carp fishing in polder water, and offers fishing guide services on board a specific boat.Fishing → Fishing Guides 15 pike 30 fishing 424 guest 1334 boat 2980 Medemblik → Andijk 242
dekstationgaasterland.nlDekstation GaasterlandDekstation Gaasterland is a stud farm specializing in the preparation for inspection, training, and sale of horses, primarily Friesian horses.Equestrian → Stallions 21 friesian horse 36 stallion 204 inspection 4279 horse 4337 training 28133 De Fryske Marren → Oudemirdum 73
gitaarschoolfriesland.nlGitaarschool FrieslandGitaarschool Friesland offers guitar and bass guitar lessons in Leeuwarden, Heerenveen and Joure, with a personalized approach and free trial lessons.Instrument → Guitar 576 Music Education → Guitar Lessons 403 bass guitar lesson 14 guitar lesson 306 style 2348 teacher 2890 lesson 5154 De Fryske Marren → Joure 689
bouwkundigburokampen.nlBouwkundigburo KampenBouwkundigburo Kampen is a construction advisory and design firm focused on residential, commercial, and agricultural projects.Architecture → Architectural Services 1006 Legal & Permits → Construction Advice 289 permits 643 sector 1332 plan 2566 design 27202 De Fryske Marren → Balk 224
pensionopekoai.nlPension Op’e KoaiPension Op’e Koai is a Bed & Breakfast located in Friesland, Netherlands, offering visitors the opportunity to relax and explore the surrounding area.Accommodation → Guesthouses 726 Nature → Cycling 472 friesland 692 b&b 1060 bike 1541 water 2501 route 3425 Heerenveen → Akkrum 246
sportnetwerkwf.nlSport Netwerk WFThe website of Sport Netwerk WF provides information and support for sports and exercise in West-Friesland.Personal Development → Talent Development 151 Emergency Services → Fire Department 138 exercise 706 sport 4228 municipality 6837 volunteer 8367 association 8562 De Fryske Marren → Lemmer 1188
taxi-jeroen.nlTaxi JeroenThe website of Taxi Jeroen offers taxi services in Heereveen and surrounding areas, including airport taxi, catering taxi, street taxi, school transport, and personal budget transport.Taxi → Regional Taxis 86 ride 1075 taxi 2090 transport 6105 appointment 13510 Heerenveen → Akkrum 246
bouwbedrijfnijdam.nlBouwbedrijf NijdamThe website of Bouwbedrijf Nijdam presents the company’s services, focused on new construction, renovation, renovation and maintenance of homes, as well as excavator rental.Construction Machinery → Excavators 52 excavator 304 new construction 2672 construction 7421 renovation 13849 maintenance 20093 De Fryske Marren → Balk 224
meijersportacademie.nlMeijer Sport AcademieMeijer Sport Academie offers sporting programs and courses, focused on the development of young athletes’ football skills.Football → Football Academies 26 Sports & Fitness → Sports Programs 367 tracksuit 22 football 1347 trainer 1966 course 14728 training 28133 Southwest-Friesland → Sneek 1921
waterstaete-tjeukemeer.nlWaterstaete TjeukemeerWaterstaete Tjeukemeer is a recreation park offering luxurious Watervilla’s and Wellness Lodges in the Frisian lake region.Boating → Marinas 825 Marine & Watercraft → Water Recreation 10 tjeukemeer 11 friesland 692 De Fryske Marren → Delfstrahuizen 47
imj.nlIMJIMJ is a civil engineering firm providing construction engineering services for various building projects.Engineering → Engineering Firms 989 Civil & Infrastructure → Construction Engineering 53 buildings 898 staff 3405 construction 7421 Southwest-Friesland → Koudum 134
vanlindeinstallatie.nlVan Linde Installatie DrachtenVan Linde Installatie Drachten is an installation company that carries out various projects in Northern Netherlands, with a focus on sustainable installations and custom solutions.Installation & Mounting → Installers 1007 hvac 56 electrical 1414 water 2501 installation 13742 sustainability 18451 Opsterland → Hemrik 35
zonnecooperatiewestfriesland.nlZonnecoöperatie West-FrieslandZonnecoöperatie West-Friesland provides a solution for people who cannot install solar panels on their own roofs, by installing solar panels on suitable roofs through a cooperative.Renewable Energy → Wind Energy 396 Context → Community 57410 cooperative 649 roof 3662 solar panels 4701 energy 9075 sustainability 18451 Medemblik → Andijk 242
straalencoatingsbedrijf.nlStraal & Coating BAKHUIZEN B.V.The Straal- en coatingsbedrijf Bakhuizen website showcases their services related to the sustainable revitalization of objects, primarily steel structures, ships, and offshore installations.Maritime → Shipbuilding 568 Building & Materials → Steel & Metal 779 offshore 124 blasting 136 coating 806 structure 1305 ship 5103 De Fryske Marren → Bakhuizen 45
brendavijn.nlBrenda Vijn UitvaartbegeleidingThe website of Brenda Vijn Uitvaartbegeleiding offers professional funeral arrangements for burials and cremations in the regions of Noordkop and West-Friesland, with a focus on creating a personal and respectful farewell ceremony.Death → Funerals 552 Family → Funeral Services 2084 burial 406 cremation 615 funeral 2477 wishes 2717 region 5412 De Fryske Marren → Lemmer 1188
kompanjon.nlDe Kompanjon BVDe Kompanjon is a real estate development company seeking partners to develop and realize real estate projects and area developments.Business Strategy → Business Development 730 Real Estate → Project Development 633 real estate project 36 real estate development 64 portfolio 6854 collaboration 16036 Southwest-Friesland → Heeg 227
lemsterpark.nlDe Kompanjon BVThe website of Lemsterpark presents a business park located in Lemmer, Friesland, suitable for companies and offices and offering an attractive location for establishment.Commercial Property → Business Parks 324 Civil & Infrastructure → Roads 252 phase 76 business park 372 plot 1051 transportation 2851 De Fryske Marren → Lemmer 1188
buitenplaatsmedemblik.nlInge KuytBuitenplaats Medemblik is a wellness center focused on reuniting humanity with nature to promote vitality and longevity, utilizing sustainable regenerative abundance and nourishing the natural world.Accommodation → Country Estates 738 Spa → Wellness Centers 238 buitenplaats 16 rest 435 wellness 1561 nature 9094 garden 13129 coach 25810 De Fryske Marren → Lemmer 1188
zuidfrieslandonstage.nlOn StageThe website ‘Onderwijs On Stage’ presents information and events related to the VMBO On Stage activity in South Friesland.Special Needs & Support → Educational Organizations 315 Employment & Labor → Labor Market 580 vmbo 198 partner 4272 school 7856 event 45199 De Fryske Marren → Balk 224
janvermaning.nlJan VermaningThe website of Jan Vermaning presents a musician active as a conductor, trumpeter, and cultural project organizer.Education & Training → Conducting 99 Culture → Cultural Industries 24 trumpeter 10 musician 1207 conductor 1217 orchestra 1315 De Fryske Marren → Joure 689
kwekerijdeinum.nlKwekerij Deinum B.V.Kwekerij Deinum is a tree nursery located in Friesland, Netherlands, offering a wide assortment of trees, shrubs, and planting supplies.Plants → Trees 304 Energy & Sustainability → Green Services 263 shrubs 148 green 889 tree 1879 plant 4509 De Fryske Marren → Wijckel 25
thuisbestdfm.nlGemeente De Fryske MarrenThe website 'Thuis Best - De Fryske Marren' provides information and support for seniors and their relatives regarding aging, home comfort, and financial aspects of living at home longer.Home Improvement → Home Modifications 22 Palliative & End-Of-Life Care → Elderly Care 1061 elderly care 128 living room 1325 bathroom 3784 finance 5341 home 7976
dorpsraad-spierdijk.nlSpierdijk Village CouncilThe website of the Spierdijk Village Council presents information about the village of Spierdijk, including its location, population, and the role of the village council.Local Communities → Villages 1005 Local Government → Village Council 479 traffic safety 99 village council 145 politics 1259 housing 4378 municipality 6837 De Fryske Marren → Lemmer 1188
zvdebron.nlZwemvereniging de BronThe website of Zwemvereniging de Bron provides information about the association, its activities, news, and contact details.Sports Clubs → Water Polo 219 swimming association 12 training sessions 81 membership 10442 news 15293 De Fryske Marren → Lemmer 1188
janhooglandmechanisatie.nlJan Hoogland MechanisatieThe website of Jan Hoogland Mechanisatie presents the current stock of tractors, attachments, machines and other agricultural equipment, as well as rental options and news.Machinery & Repair → Tractors 266 Trade → Agricultural Trade 97 attachment 208 tractor 789 stock 1154 machine 3727 rental 7257 De Fryske Marren → Sint Nicolaasga 146
dromehof.nlDromehof KringloopwinkelDromehof Kringloopwinkel Hoorn is a second-hand shop dedicated to fundraising activities and projects in Hoorn and surrounding areas, specifically aimed at combating loneliness among seniors.Social Organization → Charities 2419 Commerce → Thrift Stores 160 thrift shop 53 cause 226 pickup 736 item 1125 parking 1928 De Fryske Marren → Lemmer 1188
geenzandindustrieijsselmeer.nlKoninklijke Smals BVThe website provides information about the rejection of a plan for sand mining in the IJsselmeer, and the subsequent legal proceedings.Local Politics → Municipal Council 484 Nature → Environmental Management 529 council of state 18 municipal council 158 objection 216 Utrecht → South 328
willemdeijskoning.nlWillem de IJskoningThe website of ‘Willem de IJskoning’ presents and sells artisanal Italian ice cream, pancakes and coffee, with a focus on providing a unique experience in the Friesian town of Balk.Property Rentals → Rental 1169 Ice Cream → Ice Cream Parlors 521 ice cart 43 pancakes 568 ice cream 1000 coffee 3838 De Fryske Marren → Balk 224
esthervandijk.nlEsther van Dijk MakelaardijThe website of Esther van Dijk Makelaardij is a real estate agency specializing in the sale and purchase of properties in the Hoorn, Blokker, and Zwaag area of North Holland, Netherlands. It offers a fully managed service, including property styling and appraisals, without commission and with fixed rates.Property Valuation & Appraisal → Residential Appraisal 622 real estate agency 189 appraisal 1488 styling 2331 valuation 2697 property 7406 De Fryske Marren → Lemmer 1188
depoaskterherne.nlDe PoaskThe website of De Poask, an energy cooperative, informs visitors about the transition of Terherne to sustainable energy and invites potential members and residents to participate.Sustainability → Cooperatives 970 cooperative 649 resident 3245 energy 9075 member 10154 sustainability 18451 De Fryske Marren → Terherne 98
wbe-gaasterland.nlWBE GaasterlandThe website of WBE Gaasterland provides information about the Wildbeheereenheid Gaasterland, focused on wild boar management, hunting, and nature conservation in the area.Government & Administration → Government Organizations 1002 Nature Conservation → Wildlife Management 186 statutes 73 hunting 274 nature 9094 De Fryske Marren → Balk 224
mandvlechterij.nlMandvlechterij Aryan WesteraThe website of Mandvlechterij Aryan Westera showcases handcrafted willow basketry, including baskets, duck baskets, and birdhouses, and offers workshops and demonstrations.Woodworking → Wooden Products 66 Gardening → Birdhouses 26 willow 25 birdhouse 86 basket 275 demonstration 377 workshop 19325 Southwest-Friesland → Workum 363
wbe-veenpolders.nlWBE De VeenpoldersWBE De Veenpolders is a wildlife management unit responsible for managing wildlife in a specific area.Outdoor Activity → Hunting 184 Nature Conservation → Wildlife Management 186 hunter 85 wildlife management 125 member 10154 De Fryske Marren → Echtenerbrug 24
degreveling.nlTV de GrevelingTV de Greveling is a tennis club offering membership, court rentals, competitions, and events.Tennis → Tennis Clubs 720 Tennis → Padel 880 court 999 club 4225 agenda 4374 competition 4759 membership 10442 event 45199 De Fryske Marren → Oudehaske 49
gskv-released.nlGSKV ReleasedThe website of the Groninger Studenten Kitesurf Vereniging (GSKV) Released provides information and resources for kitesurfers, including events, lesson information, and sponsorship.Water Sports → Kitesurfing 107 Sports & Fitness → Sports Training 711 meteorology 10 kitesurfing 98 sponsors 2642 membership 10442 event 45199 Southwest-Friesland → Workum 363
huisartsenbalkwoudsend.nlHuisartsenmaatschap Balk-WoudsendThe website of the Balk-Woudsend general practice provides patients with information about the practice, opening hours, contact details, and the ability to make appointments and view their medical records.Digital & Telehealth → Patient Portals 329 Medical Care & Services → Primary Care 5699 general practice 204 record 1098 opening hours 2953 patient 4082 practice 9089 appointment 13510 De Fryske Marren → Balk 224
westerhofmakelaardij.nlWesterhof MakelaardijWesterhof Makelaardij is a real estate agency located in Akkrum and Nes, specializing in the sale and purchase of properties, property appraisals, and valuation services.Property Advice & Guidance → Property Transactions 184 Real Estate → Regional Agencies 215 agent 1253 appraisal 1488 valuation 2697 property 7406 appointment 13510 Heerenveen → Akkrum 246
saskiatuinstra.nlSaskia Tuinstra - Interior ArchitectThe website of Saskia Tuinstra - Interior Architect presents her services as an interior architect and concept designer, with a focus on unique, bespoke solutions for residential and commercial villas, fashion houses, and flexible workspaces.Interior Design → Interior Styling 676 Design → Product Design 722 concept design 24 interior architecture 137 residence 251 workspace 795 De Fryske Marren → Oudemirdum 73
huisartsenkoudumwijckel.nlHuisartsenpraktijk Koudum/WijckelThe website of the Koudum/Wijckel General Practice provides information about the practice, pharmacy services, opening hours, contact details and services, including home visits, e-consults and blood tests.Pharmaceuticals & Medical Products → Pharmacies 1029 Medical Care & Services → Primary Care 5699 blood test 200 medicine 435 pharmacy 702 doctor 1397 Southwest-Friesland → Koudum 134
hestertadema.nlREALISATIE LAAGLAND MEDIAThe website of Hester Tadema presents her as a singer and entertainment artist, with information about her performances and bookings.Performance → Live Music 1612 Recordings & Media → Singers 844 single 445 performance 7586 book 11396 music 13170 event 45199 Heerenveen → Katlijk 43
shapenstyle.nlShape 'N' StyleShape 'N' Style is a hair salon located in Balk, Friesland, specializing in creating personalized hairstyles, natural hair coloring, and the cutting of curls using the Curlsys method.Salons → Traditional Hair Salons 369 curls 229 coloring 591 hairstyle 812 salon 5541 price 8328 De Fryske Marren → Balk 224
opfokstalbeuckens.nlOpfokstal BeuckensOpfokstal Beuckens is a farm specializing in raising and caring for young foals and horses in a peaceful environment.Animal Husbandry → Horse Breeding 230 forage 82 mare 166 foal 204 stallion 204 horse 4337 De Fryske Marren → Oudemirdum 73
loonbedrijfverf.nlLoonbedrijf VerfLoonbedrijf Verf is a self-employed business operating in the agricultural sector, road and water construction, offering a range of services.Agricultural Services & Contracting → Farm Services 76 Civil & Infrastructure → Road Construction 481 machinery 519 agriculture 778 water 2501 work 3122 De Fryske Marren → Oudemirdum 73
gezondheidscentrum-bakhuizen.nlGezondheidscentrum BakhuizenThe website of Gezondheidscentrum Bakhuizen showcases the various healthcare providers and their practices.Primary Care → Health Centers 409 health center 193 lifestyle coach 193 practices 210 service provider 225 healthcare provider 474 patient 4082 De Fryske Marren → Bakhuizen 45
huizegoedereede.nlHuize Goede ReedeHuize Goede Reede offers luxury apartments for rent in the village of Oudemirdum, Friesland.Accommodation → Bungalow Parks 931 Context 161394 friesland 692 forest 1418 apartment 5088 De Fryske Marren → Oudemirdum 73
jwvfiscaal.nlAdministratie en Belasting advieskantoor J. WinkelAdministratie en Belasting advieskantoor J. Winkel is a tax advisory firm that focuses on individuals and entrepreneurs.Financial Tools → Financial Advice 204 tax advisory 134 income 660 rate 2606 collaboration 16036 De Fryske Marren → Oudemirdum 73
klusservicenijdam.nlKlus-Service NijdamThe website of Klus-Service Nijdam is a company offering complete handyman services, including maintenance, renovation, and especially bathroom and toilet renovations.Renovation → Bathroom Renovation 834 Installation & Repair → Handyman Service 70 carpenter 220 electrician 819 tile 2869 bathroom 3784 renovation 13849 De Fryske Marren → Joure 689
bouwbedrijf-bruinsma.nlBouwbedrijf Bruinsma BVThe website of Bouwbedrijf Bruinsma in Heerenveen offers services for new construction, renovation, maintenance, and repair of various types of buildings.Architecture → Historical Buildings 266 Building & Materials → Carpentry & Joinery 830 new construction 2672 building 3204 construction 7421 renovation 13849 maintenance 20093 Heerenveen → Skoatterwâld 14
velthuijsje.nlVelthuijsjeThe Velthuijsje is an accommodation offering visitors a quiet and relaxing holiday in a beautiful natural environment.Water Sports → Water Recreation 599 Nature → Nature Reserves 1032 sail 965 cycle 1906 environment 4873 nature 9094 Southwest-Friesland → Heeg 227
uweigenrekenkamer.nlUw Eigen RekenkamerUw Eigen Rekenkamer is a full-service accounting office providing financial, administrative, and tax services in Friesland.Professional Services → SME Support 20 Government & Legal → Tax 1322 financial management 138 tax advice 1522 account 5781 administration 6587 De Fryske Marren → Lemmer 1188
uitvaartfryslan.nlUitvaart FryslânThe website Uitvaart Fryslân offers funeral services in various locations throughout Friesland and provides support during the period following a death.Social Services → Grief Support 587 Family → Funeral Services 2084 farewell 1109 grief 1577 funeral 2477 wishes 2717 care 12338 Southwest-Friesland → Hindeloopen 127
klokkenstoel-goingarijp.nlklokkenstoel-goingarijp.nlThe website klokkenstoel-goingarijp.nl is an information page about the village of Goingarijp in the province of Friesland, with descriptions of the local environment, walking and cycling routes, and local history.Hiking → Walking Routes 226 cycling route 451 history 7286 nature 9094 installation 13742 sustainability 18451 De Fryske Marren → Goingarijp 86
kpj-stnyk.nlKPJ ST.NYKThe website of KPJ ST.NYK presents the activities, events, and history of the association in Sint Nyk, with a focus on building floats and organizing various recreational activities throughout the year.Carnival → Parades 76 Holidays & Commemorations → Carnival Parades 28 photo archive 55 float 159 membership 10442 event 45199 De Fryske Marren → Sint Nicolaasga 146
nieuwbouw-weststellingwerf.nlWeststellingwerf MunicipalityThe website Nieuwbouw Weststellingwerf provides a comprehensive overview of all new construction projects, purchase and rental properties in the Weststellingwerf region, including location, prices, and future developments.Instrument → Organs 177 Real Estate & Investment → Real Estate 21471 updates 200 profile 1965 property 7406 Steenwijkerland → Giethoorn 565
nieuwbouw-heerenveen.nlNieuwbouw HeerenveenNieuwbouw Heerenveen is a municipal website providing information about new construction projects, for sale and to rent properties in the Heerenveen region.Neighborhood Organizations → Residents’ Associations 965 Planning & Development → Spatial Planning 889 region 5412 property 7406 De Fryske Marren → Lemmer 1188
dorpsbehoudlemsterland.nlStichting Dorpsbehoud LemsterlandThe Stichting Dorpsbehoud Lemsterland is an organization dedicated to preserving and restoring the village character and characteristic buildings within the former municipality of Lemsterland.Cultural Heritage → Heritage Preservation 51 donator 16 monument 1168 restoration 3417 foundation 6678 's-Hertogenbosch → Empel 51
facesound.nlFacesoundThe Facesound Lemmer website presents a collection of the history, sale, rental, and exhibitions of vintage stage equipment and the Facesound studio.Museums & Collections → Music History 82 Visual Arts → Museums 2049 equipment 4143 exhibition 5332 studio 5465 sale 5930 rental 7257 collection 7566 De Fryske Marren → Lemmer 1188
ebenhaezerlemmer.nlProtestantse Gemeente van bijzondere aard op Gereformeerde Grondslag ‘Eben-Haëzer’The website of the Protestant Congregation of Special Character on Reformed Foundation ‘Eben-Haëzer’ in Lemmer provides information about the congregation and its activities.Protestantism → Reformed 1323 Religious Life → Local Congregations 31 congregation 302 youtube 486 church service 879 childcare 3512 De Fryske Marren → Lemmer 1188
lemsterkrant.nlLemsterkrantLemsterkrant is an online platform that provides news and information about Lemmer and the surrounding region.Local & Regional → Regional News Sources 23 News & Journalism → News Websites 340 visitors 1048 message 2260 region 5412 video 6714 photo 7778 news 15293 De Fryske Marren → Lemmer 1188
dekattenherberg.nlDe KattenherbergDe Kattenherberg is a vacation address for cats located on the shores of the IJsselmeer in Lemmer.Accommodation → Pensions 46 cat 1578 accommodation 4921 photo 7778 care 12338 De Fryske Marren → Lemmer 1188
aoa-glasvezel.nlArt Of Automation GlasvezelArt Of Automation Glasvezel offers business fiber internet solutions to entrepreneurs and institutions.Internet → Fiber Optic Internet 100 IT → Network Solutions 45 bandwidth 37 fiber 167 coverage 348 network 11123 De Fryske Marren → Lemmer 1188
vanrhee.nlVan Rhee InstallatietechniekVan Rhee Installatietechniek is an installation company providing services in Lemmer and surrounding areas, with a focus on sustainability and projects.News & Journalism → Regional News 948 roof 3662 installation 13742 sustainability 18451 De Fryske Marren → Lemmer 1188
cafethert.nlCafé 't HertCafé 't Hert is a unique pub in Joure offering event space rentals for various occasions.Brasseries & Bistros → Bistro 594 led screen 63 venue 879 bar 1216 terrace 4847 event 45199 De Fryske Marren → Joure 689
domien.nlDomien Silvius Spuit- & SchilderwerkDomien Silvius Spuit- & Schilderwerk is a company that offers painting, spraying, and metal conservation services.Home Improvement → Decorating 333 Household & Cleaning → Spraying 387 spray 658 metal 1090 paint 8747 De Fryske Marren → Joure 689
sporza-fitness.nlSporzaSporza is a fitness center located in Joure, Grou, and Bolsward, offering high-quality fitness equipment and various activities including group classes, personal training, and corporate fitness.Group Class → Fitness Centers 1010 Human Resources → Corporate Fitness 74 cardio equipment 22 strength equipment 31 corporate fitness 34 fitness center 46 group classes 1306 Southwest-Friesland → Bolsward 566
tsjukemarplannen.nlStichting Kulturele Rûte TsjûkemarThe website provides information about various projects and initiatives in and around the Tsjûkemar, a regional lake in Friesland, focused on recreation, education, and sustainability.Nature → Water Bodies 17 Nature Conservation → Water Management 1138 recreation 799 education 13471 sustainability 18451 De Fryske Marren → Sint Nicolaasga 146
garageswart.nlGarage Swart B.V.The Garage Swart website is an online resource for automotive services, including car sales, maintenance, and repairs, focused on the region of WIJCKEL.Auto Repair Services → General Repairs 44 Cars (Brands) → Toyota 145 mot 806 occasion 2036 car 10865 accessories 12975 workshop 19325 maintenance 20093 De Fryske Marren → Wijckel 25
desnaijerstucadoors.nlStucadoors en spuitbedrijf de Snaijer B.V.Stucadoors en spuitbedrijf De Snaijer B.V. is a company specializing in plastering, painting, and facade insulation, offering services for private, corporate, and housing corporation projects.Building & Materials → Plastering & Rendering 468 facade insulation 73 plaster 2175 paint 8747 quote 12863 De Fryske Marren → Lemmer 1188
sijbesma-interieur.nlSijbesma InterieurThe website of Sijbesma Interieur is an online presentation of an interior specialist based in Minnertsga, offering flooring, window coverings, and other furnishing elements.Interior → Flooring 2791 floor 4781 shop 6483 collection 7566 interior 8093 De Fryske Marren → Lemmer 1188
zeilschoolup.nlZeilschool UpZeilschool Up is a youth sailing school offering sailing holidays and sailing camps to young people.Sailing → Sailing Schools 70 Tourism → Holidays 1086 sailing camp 21 sail 965 boat 2980 instructor 3126 De Fryske Marren → Balk 224
vriendsloopwerken.nlP. Vriend B.V.P. Vriend B.V. is a company specializing in demolition, asbestos removal, soil remediation, and transportation, operating in West Friesland and North Holland.Building Science & Analysis → Construction Science 11 Environment → Environmental Remediation 15 asbestos removal 134 soil remediation 149 demolition 1144 transportation 2851 safety 5819 De Fryske Marren → Lemmer 1188
zwemschooldefryskemarren.nlZwemschool De Fryske MarrenZwemles Joure is a website of Zwemschool De Fryske Marren offering swimming lessons and promoting swimming safety for children.Water Activity → Swimming 1402 diploma 795 swimming 850 water 2501 instructor 3126 safety 5819 De Fryske Marren → Joure 689
lemstersjerke.nlStichting Lemster SjerkeThe website of Stichting Lemster Sjerke is a meeting place in Lemmer that aims to connect people through inspiring events and a unique location.Venues → Halls 419 Protestantism → Reformed 1323 hall 1786 church 3439 community 7931 event 45199 De Fryske Marren → Lemmer 1188
zvv-haskerland.nlZVV HaskerlandThe website of ZVV Haskerland, a hall football club from Joure, presents information about the club, its teams, history and news.Football → Youth Football 202 Football → Indoor Football 108 knvb 34 competition 4759 history 7286 news 15293 De Fryske Marren → Sint Nicolaasga 146
bregepopfestival.nlBregepopThe website provides information about the Bregepop Festival, which takes place on April 12th and 13th, 2024, in Scharsterbrug, Friesland, marking the start of the festival season in the north.Festivals → Music Festivals 1020 site 422 visitors 1048 festival 3804 performance 7586 De Fryske Marren → Joure 689
stokerkoffiebar.nlStoker Coffee BarThe Stoker Coffee Bar website introduces the coffee bar, its menu, and an upcoming webshop, inviting visitors to visit the location in Joure.Beverages → Tea 829 Gifts → Gift Cards 981 coffee bar 111 coffee beans 452 lunch 1534 coffee 3838 drink 5191 atmosphere 5591 De Fryske Marren → Joure 689
bungalowparkmarkant.nlBungalowpark MarkantBungalowpark Markant is a holiday park located on the Slotermeer in Friesland, Netherlands, aimed at water and nature lovers.Water → Lakes 232 Accommodation → Bungalow Parks 931 watersport 540 bungalow 687 friesland 692 park 1863 De Fryske Marren → Balk 224
fanooij.nlFa. NooijFa. Nooij is a household appliance specialist in Hauwert offering repair, maintenance, and sales of domestic appliances.Household Appliances → White Goods 132 white goods 63 washing machine 487 television 709 appliance 956 sale 5930 repair 14576 De Fryske Marren → Lemmer 1188
cocoonbalk.nlCocoonCocoon is an online store that sells furniture, home accessories, and clothing.Clothing → Men’s Clothing 1008 Clothing → Women’s Clothing 643 home accessories 603 security 6655 furniture 8751 clothing 9443 De Fryske Marren → Balk 224
taalryk.nlCedin onderwijsThe website of Taalryk presents multilingual secondary education, where students learn foreign languages (such as English) alongside regular subjects and gain international experiences.Primary & Secondary Schooling → Secondary Education 1639 Higher Learning → Educational Institutions 1049 multilingualism 26 language 2016 student 7623 school 7856 education 13471 Southwest-Friesland → Koudum 134
oefentherapiefriesland.nlOefentherapie FrieslandOefentherapie Friesland offers physiotherapy services in various locations in Friesland with extensive experience in helping people with various complaints.Pain → Pain Syndromes 12 Physical Therapy → Exercise Therapy 354 muscle 498 posture 548 movement 2304 physiotherapy 4688 complaint 6479 De Fryske Marren → Balk 224
mondhygienistenpraktijklemmer.nlMondhygienisten Praktijk LemmerMondhygienisten Praktijk Lemmer provides oral hygiene treatments and preventative care aimed at a healthy mouth and a radiant smile.Dentistry → Oral Hygiene 750 mouth 80 hygienist 190 teeth 680 prevention 1763 treatment 21203 De Fryske Marren → Lemmer 1188
byboonstra.nlBakkerij By BoonstraThe website of Bakkerij By Boonstra presents the bakery with two locations in Heerenveen and De Knipe and offers online ordering and information about its products, including the renowned Oranjekoek.Bakery & Food Production → Bread 765 Food Delivery → Delivery 2227 delivery service 236 pastries 946 bread 1622 store 3901 recipe 5142 Het Hogeland → Rottum 38
greetjefeenstra.nlGreetje FeenstraThe website of Greetje Feenstra showcases her artwork as a visual artist, including paintings (landscapes, flowers), acrylic painting workshops, and opportunities for commissioned paintings and exhibitions.Painting → Impressionism 94 landscape 2609 paintings 3907 workshop 19325 De Fryske Marren → Harich 35
smaakwinckel.nlSmaakwinckelThe website of Smaakwinckel is a lunchroom and delicatessen shop in Balk, where visitors can enjoy coffee, pastries, fresh lunches, and regional products.Dairy & Cheese → Delicatessens 617 Food → Local & Regional Products 930 regional products 391 cheese 1205 coffee 3838 sandwich 4098 terrace 4847 catering 6456 De Fryske Marren → Balk 224
campingvalkenhof.nlCamping ValkenhofThe Camping Valkenhof website provides information about the campsite location in West-Friesland, including facilities, prices, and contact details.Landscape → Fields 16 west-friesland 41 pitch 332 sanitary 750 city 1875 campsite 2093 price 8328 De Fryske Marren → Lemmer 1188
msbtjongerschans.nlMedisch Specialistisch Bedrijf Tjongerschans (MSB Tjongerschans)The Medisch Specialistisch Bedrijf Tjongerschans (MSB Tjongerschans) is a collaboration of medical specialists providing high-quality care.Specialized Medical Services → Specialized Care 384 medical specialist 24 department 269 hospital 560 vacancy 6598 care 12338 De Fryske Marren → Lemmer 1188
gmrambion.nlGMR AmbionThe GMR Ambion website provides information and resources for the members of the collective employee representation council of the Ambion public school network, representing the staff and parents of schools in the Joure and Heerenveen regions.Municipalities → Governance 1043 Social Issues → Participation 1023 representation 100 budget 1335 meeting 2381 De Fryske Marren → Joure 689
monumentenschagen.nlMunicipality of SchagenThe Monumenten Schagen website provides cycling routes and information about monuments in the municipality of Schagen and surrounding villages, with a focus on the Monument Day event.Local History → Dutch History 1067 Cycling → Cycling Routes 1002 west-friesland 41 cycling route 451 monument 1168 history 7286 De Fryske Marren → Lemmer 1188
oveigenhaard-destikke.nlOndernemersvereniging Eigen Haard / De StikkeThe website of Ondernemersvereniging Eigen Haard / De Stikke provides information about the association, its activities, and affiliated companies located in the Eigen Haard and De Stikke industrial area in Balk.Associations → Regional Associations 292 board 3438 association 8562 member 10154 De Fryske Marren → Balk 224
si-jak.nlStichting Koreaanse Krijgskunsten Si-JakThe website of Si-Jak (SKK) presents information about HapKiDo and Kyusho Jitsu lessons in various locations, including Zaltbommel, Varik, Ophemert and Follega, catering to both recreational and competitive training.Sports & Fitness → Sports Training 711 Martial Art → Korean Martial Arts 46 hapkido 26 acupuncture 1537 technique 2157 West-Betuwe → Varik 59
watersportreus.nlWatersportReusThe WatersportReus website offers professional maintenance and repair services for boats and motors, including boat transport, engine installation, and damage repair.Boating → Boat Maintenance 183 Water → Boats 935 sloop 272 motor 614 boat 2980 transport 6105 repair 14576 maintenance 20093 De Fryske Marren → Lemmer 1188
patsongedierte.nlPATS! Pest and Vermin ControlPATS! Pest and Vermin Control offers friendly pest and vermin control services in the Noordoostpolder and surrounding areas.Control → Pest Control 824 pest control 144 animal 2908 region 5412 De Fryske Marren → Balk 224
meldpuntverkeersveiligheiddfm.nlVVD De Fryske Marren and Kleurrijk De Fryske MarrenThis website serves as a reporting point for unsafe traffic situations in the region of De Fryske Marren, managed by VVD De Fryske Marren and Kleurrijk De Fryske Marren.Safety → Traffic Safety 117 Context 161394 redesign 25 traffic safety 99 situation 655 report 4551 region 5412
winkeleninbalk.nlBalk Business AssociationThis website provides information about the town of Balk, including its history, shopping options, and recreational activities.Places → Towns 380 street 281 bridge 557 forest 1418 shop 6483 De Fryske Marren → Balk 224
ijswegencentralesloten.nlIJswegencentrale SlotenThe website of IJswegencentrale Sloten describes the activities of the organization, which manages and maintains ice roads in Friesland, particularly in the Southwest corner and around the Slotermar.Skating → Ice Rinks 475 skater 24 ice 178 skating 314 friesland 692 De Fryske Marren → Balk 224
rkpctoekomst.nlIKC De ToekomstThe website of IKC De Toekomst presents the school and childcare, providing information on registration, the team, education, and childcare, as well as practical information and news.Primary Education → Protestant Schools 74 Higher Learning → Educational Institutions 1049 childcare 3512 environment 4873 school 7856 community 7931 education 13471 De Fryske Marren → Bakhuizen 45
kitez.nlKitezThe website Kitez.nl is a shop and test center for kitesurfing equipment and toys, specializing in kitesurfing, wingsurfing, and SUP, with a focus on brands like Ozone, F-One, Ensis, STX, and Manera.Water Sports → Kitesurfing 107 Apparel → Sporting Goods 1374 wing 42 ozone 51 kite 72 sup 233 board 3438 De Fryske Marren → Mirns 22
uitvaartverenigingnannewiid.nlUitvaartvereniging NannewiidUitvaartvereniging Nannewiid is a cooperative organization that provides funeral services in a dignified manner.Social Services → Grief Support 587 Social Issues & Welfare → Social Issues 18544 burial 406 cremation 615 funeral 2477 wishes 2717 association 8562 Het Hogeland → Rottum 38
gebrdevries.nlGebr. de Vries B.V.Gebr. de Vries is a construction and excavation company offering services to governments, businesses, and individuals.Agriculture → Agricultural Services & Contracting 708 Land Development & Earthworks → Earthmoving 643 grade 79 excavation 382 earthwork 435 landscaping 1529 transport 6105 construction 7421
energietoeslagaanvragen.nlEnergietoeslagaanvragen.nlThe website provides information about energy allowance in Dutch municipalities.Social Services → Assistance Services 627 Legal → Rights 28 application 3377 municipality 6837 Amsterdam → Weesp 1005
loonbedrijfhoekstra.nlLoonbedrijf HoekstraThe website of Loonbedrijf Hoekstra presents the services and activities of a rental business located in Friesland, operating in the agricultural sector but also serving construction companies, contractors, and individuals.Property Rentals → Rental 1169 Agriculture → Agricultural Services & Contracting 708 soil cultivation 43 mowing 61 corn 101 fertilization 122 drainage 1322 rental 7257 De Fryske Marren → Oosterzee 29
daaldersplekbantega.nlDaaldersplek BantegaDaaldersplek Bantega is a Bed and Breakfast located in the Frisian countryside, offering guests the opportunity to enjoy nature and the surrounding area.Nature → Natural Areas 257 Nature → Forest 387 bed and breakfast 305 forest 1418 hospitality 3491 apartment 5088 nature 9094 Noordoostpolder → Bant 57
bouwbedrijfhk.nlBouwbedrijf HKBouwbedrijf HK is a construction company specializing in both large-scale projects and private homes.Building & Construction → Renovation 4403 vision 1882 carpentry 2218 construction 7421 education 13471 De Fryske Marren → Bantega 19
burowietzedijkstra.nlBuro Wietze DijkstraOntwerpburo Wietze Dijkstra is an independent architectural firm that designs and executes projects for a variety of clients.Architecture & Design → Engineers 60 Architecture & Design → Architectural Consulting 490 building 3204 house 8121 design 27202 De Fryske Marren → Terherne 98
kinderopvangmadelief.nlKinderopvangmadeliefKinderopvangmadelief is a small-scale, agricultural daycare center located in Delfstrahuizen, focused on providing a playful and educational environment for children.Early Years → Childcare 6029 daycare 1365 farm 2622 animal 2908 clothing 9443 De Fryske Marren → Delfstrahuizen 47
robdewitloodgieter.nlRob de Wit de dakgootspecialistThe website of Rob de Wit de dakgootspecialist showcases the services of a craftsman specializing in zinc, copper, and lead work, with a focus on gutter repairs, replacements, and renovations in West-Friesland and North Holland.Metals → Copper 32 Roofing → Gutters 154 copper 145 zinc 367 gutter 550 leak 1204 plastic 1232 renovation 13849 De Fryske Marren → Lemmer 1188
drukkerijdevries.nlDrukkerij G. de VriesThis website serves as an online platform for ordering printing services from Drukkerij G. de Vries in Echtenerbrug, including stickers, birth and wedding cards, letter stickers and other printing products. It also offers options for mail orders and pick-up locations.Photography → Photo 204 printing service 44 greeting card 335 stickers 777 print 5511 order 6912 De Fryske Marren → Echtenerbrug 24
frankotmachines.nlFrankot MachinehandelFrankot Machinehandel is a company specializing in the sale, repair, and maintenance of machining machines and solar panels.Business → Industry 36977 machine 3727 solar panels 4701 repair 14576 maintenance 20093 De Fryske Marren → Delfstrahuizen 47
jumbojoure.nlJumbo Joure ZijlstraThe website of Jumbo Joure Zijlstra presents the store, its opening hours, assortment and social media channels.Websites → Local Businesses 85 Supermarkets & Grocery → Local Supermarkets 56 fresh 26 artisanal 56 opening hours 2953 store 3901 De Fryske Marren → Joure 689
osteopathievandiepen.nlOsteopathie van DiepenOsteopathie van Diepen is an osteopathy practice offering treatment to clients in the Lemmer, Friesland area.Physical Therapy → Osteopathy 922 Medical Care & Services → Specialized Medicine 20 osteopath 22 movement 2304 body 3490 complaint 6479 treatment 21203 De Fryske Marren → Lemmer 1188
deburcht-meilan.nlCBS De BurchtCBS De Burcht is a primary school in Heerenveen that aims to help children discover themselves and develop a positive identity.Elementary Schools → Christian Primary Schools 342 Primary Education → Christian Education 446 parent 4318 school 7856 child 11566 education 13471 Friesland → Heerenveen 2578
deroerganger-meilan.nlThe RoergangerThe Roerganger is a Christian primary school providing a safe learning environment and encouraging children’s development.Elementary Schools → Christian Primary Schools 342 Elementary Schools → Public Elementary Schools 406 respect 254 method 1505 talent 3987 school 7856 Friesland → Heerenveen 2578
spring-meilan.nlCBS SpringThe website of CBS Spring is an information portal for parents, students and visitors to the primary school, focused on providing a supportive learning environment where children can discover themselves and thrive.Education → Pedagogy & Methods 2944 primary education 52 upbringing 95 learning 920 parent 4318 student 7623 school 7856 Friesland → Heerenveen 2578
dehoeksteen-meilan.nlCBO MeilânThe website of basisschool de Hoeksteen and CBO Meilân presents the schools, their vision, programs and activities to parents and visitors.Primary Education → Public Education 424 Government & Administration → Local Municipalities 219 vision 1882 student 7623 school 7856 Friesland → Heerenveen 2578
eaborgerschool-meilan.nlCBO MeilânThe website of E.A. Borgerschool and CBO Meilân provides information about the schools, their mission, vision, policies, and educational offerings, as well as the organization behind the schools.Elementary Schools → Christian Primary Schools 342 Business & Management → Educational Foundations 54 talent 3987 municipality 6837 student 7623 school 7856 education 13471 Friesland → Heerenveen 2578
haskerwiis-meilan.nlCBO MeilânThe website of Basisschool Haskerwiis Oudehaske and CBO Meilân describes the educational institutions, their approach, and available services, focusing on a stimulating learning environment and a multilingual approach.Primary Education → Public Education 424 Primary Education → Dalton Education 143 student council 29 language 2016 school 7856 education 13471 Friesland → Heerenveen 2578
muzykoanepoel.nlMuzyk oan 'e poelMuzyk oan 'e poel is an organization that organizes music concerts in Goingarijp.Ensemble → Chamber Music 466 Instrument → Instrumental Music 197 harp 86 flute 173 concert 4409 music 13170 De Fryske Marren → Goingarijp 86
rose-zomerfestival.nlRosé Zomerfestival 2024The Rosé Zomerfestival 2024 is a gastronomic event taking place on July 21st in Terherne, where visitors can enjoy food paired with rosé wine.Festivals → Food 23 Outdoor → Terraces 188 rosé 28 chef 631 wine 4476 restaurant 11215 De Fryske Marren → Terherne 98
voorwaartsterherne.nlSportvereniging VoorwaartsSportvereniging Voorwaarts offers a variety of sports activities for all ages in Terherne.Board → Skateboarding 107 Martial Art → Brazilian Jiu-Jitsu 84 skates 148 trial 398 class 2076 sport 4228 De Fryske Marren → Terherne 98
autobedrijfjentjezantema.nlAutobedrijf Jentje ZantemaAutobedrijf Jentje Zantema is an automotive dealership focused on reliable and high-quality vehicles and offers financial lease and financing options.Car Selling & Valuation → Passenger Cars 992 reliability 235 lease 1595 showroom 4883 car 10865 De Fryske Marren → Joure 689
bouwkemper.nlKemper BouwKemper Bouw is a construction company offering building and renovation services in the area around Sneek and Scharnegoutum.Construction Companies → Construction Contractors 536 Building & Materials → Carpentry & Joinery 830 construction company 824 carpentry 2218 new construction 2672 renovation 13849 maintenance 20093 Heerenveen → Akkrum 246
atsmaschoon.nlAtsma SchoonmaakbedrijfAtsma Schoonmaak is a professional cleaning company providing services in Joure and surrounding areas.Local & Regional Focus → Local Businesses 1077 Notaries → Notary Office 82 office 2898 employee 4429 cleaning 4567 home 7976 price 8328 De Fryske Marren → Joure 689
muurling.nlH.J. Muurling AssurantiënMuurling Assurantiën Joure is an independent insurance broker office that provides financial security to individuals and entrepreneurs in Joure, since 1993.Insurance & Risk → Insurance Brokerage 244 advisor 1055 reviews 3172 mortgage 4564 insurance 6359 sustainability 18451 De Fryske Marren → Joure 689
holtropbeheer.nlA.Holtrop Beheer b.v.A.Holtrop Beheer b.v. is a company specializing in project development, workplace housing, and participations.Investing → Real Estate Investing 707 Real Estate → Project Development 633 workplace housing 16 project development 215 commercial property 469 Hardenberg → Dedemsvaart 413
meimekoar.nlMei MeKoarThe website of Mei MeKoar describes the activities of a choir, particularly their involvement in commemorating victims of World War II in Jirnsum and their participation in various musical events.World War II → Remembrance 120 commemoration 181 ceremony 824 choir 3123 music 13170 event 45199 De Fryske Marren → Joure 689
dejongdewal.nlBouwbedrijf De Jong & De WalBouwbedrijf De Jong & De Wal is a construction company based in Grou, Friesland, offering various construction and maintenance services.Technical Services → Maintenance Companies 517 Technical Services → Technical 957 hydraulic 234 property 7406 construction 7421 house 8121 renovation 13849 De Fryske Marren → Boornzwaag 17
ratechniek.nlRA TechniekRA Techniek is a technical installation company based in Joure that provides advice and installation services for residential and commercial spaces.Installation & Mounting → Construction Installation 175 ventilation 1110 electrical 1414 heat 2188 bathroom 3784 kitchen 6443 installation 13742 De Fryske Marren → Joure 689
lyts-sypenstien.nlLyts SypenstienLyts Sypenstien is a vacation rental complex offering luxurious holiday homes in Friesland, catering to both relaxing and active holidays.Accommodation → Bungalow Parks 931 Nature → National Parks 898 vacation home 488 forest 1418 vacation 4234 home 7976 De Fryske Marren → Sint Nicolaasga 146
tipdefryskemarren.nlGemeente De Fryske MarrenTipDeFryskeMarren is a digital panel that allows residents of De Fryske Marren to share their opinions and ideas on current topics.Online Services & Platforms → Participation Platforms 74 Context 161394 opinion 417 questionnaire 666 topic 1238 idea 2367 municipality 6837
jousterhuisartsen.nlJouster House PhysiciansThe website of Jouster House Physicians provides information about the practice, the treating doctors, various healthcare services, and practical information for patients.Patient Services & Rights → Patient Information 158 Medical Care & Services → Primary Care 5699 general practitioner 508 prescription 859 healthcare 2316 patient 4082 practice 9089 appointment 13510 De Fryske Marren → Joure 689
snoekvissen.nlDe VlietlandenThe website ‘De Stek’ offers sport fishermen a comprehensive arrangement for a successful fishing adventure in the ‘De Vier Noorder-koggen’ polder.Fishing → Angling 159 Accommodation → Bungalow Parks 931 bungalow park 81 fishing water 87 boat rental 124 De Fryske Marren → Lemmer 1188
foppie.nlt Hasker AssurantiekantoorThe website of 't Hasker Assurantiekantoor provides financial advice and support to individuals and businesses in the Oudehaske Friesland region, offering services from RegioBank.Personal Finance → Financial Planning 1017 Banking & Payments → Banking 361 banking 108 loan 832 investment 2070 mortgage 4564 insurance 6359 De Fryske Marren → Oudehaske 49
mattheusjoure.nlIKC Sint MattheüsThe website of IKC Sint Mattheüs provides information about the integral child center, including childcare, education, and contact information.Primary Education → Catholic Primary Education 380 Childcare → After-School Care 765 director 716 center 1115 daycare 1365 school 7856 education 13471 collaboration 16036 De Fryske Marren → Joure 689
rederijtoering.nlRederij ToeringRederij Toering is a family-owned company that provides and rents offshore vessels and support ships.Freight & Logistics → Courier Services 839 Marine & Shipping → Maritime 1022 offshore 124 ship 5103 De Fryske Marren → Lemmer 1188
pandhuys.nlPandhuysThe website of Pandhuys Joure offers services for the melting and selling of gold and silver jewelry.Investing → Precious Metals 326 Accessories → Jewelry 3517 cash 61 precious metal 78 jewelry 4599 De Fryske Marren → Joure 689
larsmulder.nlHal Leonard MGBThe website presents the works and background of composer Lars Mulder.Composition & Theory → Composers 175 Personal → Biography 1003 composer 412 composition 639 piano 820 choir 3123 music 13170 De Fryske Marren → Joure 689
deveken.nlDe Veken KvKThe website provides information about the De Veken business park in Opmeer, West-Friesland.Commercial Property → Business Parks 324 Context 161394 rule 61 expansion 136 business park 372 municipality 6837 De Fryske Marren → Lemmer 1188
kunstgebitfriesland.nlKunstgebit FrieslandKunstgebit Friesland provides denture repair, new dentures, and cleaning services to residents of Friesland, offering free pickup and delivery.Dentistry → Dentures 88 denture 462 insurance 6359 repair 14576 De Fryske Marren → Joure 689
local-vocals.nlThe Local VocalsThe website of The Local Vocals presents an enthusiastic women's choir based in Joure, Friesland.Choir → Women’s Choir 179 Education & Training → Singing 878 singing 1056 repertoire 2497 choir 3123 member 10154 De Fryske Marren → Joure 689
moaiskarsterlan.nlVereniging Moai SkarsterlânThe Vereniging Moai Skarsterlân is a association dedicated to protecting the landscape, flora, fauna, and living environment of the region.Nature → Nature Organizations 104 Nature Conservation → Landscape Conservation 114 fauna 143 flora 171 landscape 2609 newsletter 6504 De Fryske Marren → Joure 689
fysiosintnicolaasga.nlFysio Sint NykThe website of Fysio Sint Nyk is a physiotherapy practice located in Sint Nicolaasga, focused on treating injuries and painful complaints.Pain → Chronic Pain 240 injury 543 pain 1919 patient 4082 physiotherapy 4688 treatment 21203 De Fryske Marren → Sint Nicolaasga 146
jogofotografie.nlJo&Go FotografieThe website of Jo&Go Photography showcases a blog and a collection of photos from various events and locations, including landscapes, architecture, and classic cars.Europe → Austria 249 Outdoor & Recreation → Rural Events 18 photo album 686 archive 2067 landscape 2609 portfolio 6854 photography 9503 event 45199 Opsterland → Hemrik 35
boersmaschoenen.nlBoersma SchoenenThe website of Boersma Schoenen presents an online shop with shoes and accessories, as well as information about the stores in Joure and Grou.Shoes → Men’s Shoes 153 Shoes → Women’s Shoes 164 shoes 2699 store 3901 brand 17737 De Fryske Marren → Joure 689
koeienvoeren.nlKoeienvoerenThe website Koeienvoeren.nl provides information about a company specializing in the provision of mixed feed for livestock, with a focus on the southern part of Friesland.Horses → Feed 122 Building & Renovation → Business Listings 37 livestock 207 farmer 661 feed 672 De Fryske Marren → Tjerkgaast 16
vamosvastgoed.nlVAMOS Vastgoed B.V.Vamos Vastgoed is a real estate advisory and brokerage firm that operates with both its own and external portfolios.Real Estate & Investment → Intangible Assets 123 transaction 613 real estate 4981 portfolio 6854 communication 10162 collaboration 16036 De Fryske Marren → Joure 689
heibedrijfhoekstra.nlHeibedrijf HoekstraThe website of Heibedrijf Hoekstra presents the company’s services, specializing in the heaving of prefabricated concrete piles, with an emphasis on sustainability, noise reduction, and reliable project execution.Construction Technology → Foundation Technology 135 Construction Industry & Methods → Sustainable Construction 1391 machine 3727 foundation 6678 sustainability 18451 Southwest-Friesland → Workum 363
piedijk.nlPiedijk MuntenPiedijk Munten is an online shop specializing in the sale of old coins, antiques, and collectibles, with a focus on provincial and overseas coins.Antiques & Collectibles → Vintage 623 coin 313 antique 432 category 2316 ship 5103 sale 5930 De Fryske Marren → Lemmer 1188
geleendegezichten.nlStichting Geleende GezichtenThe website ‘Geleende Gezichten’ presents information about a historical art project by visual artist Ada Stel, linked to the municipality of Joure. The project encompasses portraits, including works from the ‘Geleende Gezichten’ series and portraits of children who lost their lives during World War II.Specialized History → World War II 1134 lecture 1624 portrait 3685 exhibition 5332 De Fryske Marren → Joure 689
kistemakerbouw.nlKistemaker BouwKistemaker Bouw is a construction company specializing in renovation, foundation repair, and basement construction.Cars → Classic Cars 1145 Historical Sites → Monuments 1027 basement 134 tradition 736 building 3204 foundation 6678 renovation 13849 De Fryske Marren → Lemmer 1188
rocda.nlRocda Vloerenservice BVRocda Vloerenservice BV is a specialist in the delivery and installation of high-quality concrete floors.Interior → Flooring 2791 Concrete & Cement → Concrete Floors 60 durable 30 concrete floor 184 maintenance 20093 De Fryske Marren → Lemmer 1188
omc-andijk.nlOMC AndijkOMC Andijk is a trailer and boat trailer sales and rental company.Marine & Watercraft → Water Recreation 10 Road Services → Automotive 18764 boat trailer 23 trailer 1624 inspection 4279 sale 5930 rental 7257 maintenance 20093 De Fryske Marren → Lemmer 1188
zijlstrabetonafwerking.nlZijlstra Betonafwerking BVZijlstra Betonafwerking is a specialized company offering concrete finishing services for both commercial and private purposes.Concrete & Cement → Concrete Floors 60 Renovation → Flooring Renovation 208 design floor 10 concrete floor 184 polish 269 concrete 973 floor 4781 De Fryske Marren → Sint Nicolaasga 146
rijschoolteamjacob.nlRijschool Team JacobRijschool Team Jacob offers driving lessons and exam preparation in Lemmer and surrounding areas.Testing → Exams 108 driving instructor 252 exam 2120 driving lessons 2453 car 10865 De Fryske Marren → Echtenerbrug 24
wingdesign.nlWING DESIGNWING DESIGN is a specialist in interior design and interior construction, transforming spaces into inspiring environments and offering tailored solutions for both private and business clients.Finishing & Trades → Interior Construction 502 Decor & Furnishings → Interior Design 2317 3d visualization 99 interior construction 240 interior design 1802 furniture 8751 De Fryske Marren → Lemmer 1188
begraafplaatsharichruigahuizen.nlStichting Kerkhoven Harich and RuigahuizenThis website provides information about the cemeteries of Ruigahuizen and Harich, managed by the Stichting Kerkhoven Harich and Ruigahuizen.Monuments → Cemeteries 172 Protestantism → Churches 1009 beneficiary 21 cemetery 395 stichting 481 village 808 church 3439 De Fryske Marren → Ruigahuizen 13
bthpostma.nlAannemer Metselwerk B. Th. Postma BVAannemer Metselwerk B. Th. Postma BV is a masonry contractor with a long tradition that undertakes projects and supplies scaffolding.Masonry & Plastering → Masonry 576 Building & Materials → Scaffolding 328 masonry 460 scaffolding 519 plaster 2175 partner 4272 De Fryske Marren → Sint Nicolaasga 146
burostadenland.nlBuro Stad en LandBuro Stad en Land provides advice and design plans for spatial planning, with a focus on landscape design, urban planning, and sustainability.Urban Planning → Public Space 188 Planning & Development → Spatial Planning 889 visualization 621 planning 1969 landscape 2609 design 27202 Noordenveld → Norg 322
hielkemabouw.nlHalbe Hielkema – Construction & MaintenanceThe website of Halbe Hielkema – Construction & Maintenance presents the company as a contractor specializing in new construction, renovations, maintenance, and repairs of buildings, as well as the sale of plastic frames, greenhouses, and roof windows.Frames → Plastic Frames 340 plastic frames 95 construction 7421 house 8121 quote 12863 renovation 13849 maintenance 20093 De Fryske Marren → Nijemirdum 19
mondzorgsintnyk.nlMondzorg Sint NykThe website of Mondzorg Sint Nyk is dedicated to providing preventive dental care and various treatments for gum problems, teeth whitening, and advice, with a focus on the patient’s overall health.Dentistry → Dental Hygienist 651 dental hygienist 522 health 6366 appointment 13510 De Fryske Marren → Sint Nicolaasga 146
ovsintjut.nlOranjevereniging Sintjohannesga e.oThe website of Oranjevereniging Sintjohannesga e.o. serves as an information hub for the association, its activities and events, including village festivals and tractor dexterity competitions. It also provides information about the association's consumption coins and membership.Local Events → Village Festivals 219 Village Focus → Village Organizations 683 photobooth 359 archive 2067 membership 10442 De Fryske Marren →  Sintjohannesga 24
bedenbreakfastindestreek.nlB&B In de StreekB&B In de Streek is a bed & breakfast located between Hoorn and Enkhuizen, offering accommodation for visitors exploring the region.Hiking → Trails 356 Museums → Regional Museums 390 b&b 1060 museum 2002 region 5412 De Fryske Marren → Lemmer 1188
winterbergingdijkstra.nlWinterberging DijkstraThe website of Winterberging Dijkstra offers winter storage and maintenance services for campers, motorboats, sailboats and other watercraft, located centrally on the Luts in Balk, Friesland.Marine & Watercraft → Boat Sales 144 motorboat 128 winter storage 182 camper 1596 maintenance 20093 De Fryske Marren → Balk 224
bungalowparkiselmar.nlAssociation of Bungalowpark IselmarThe website of the Association of Owners of Bungalowpark Iselmar provides practical information about the bungalow park, including maps, contact details, and a login for members.Accommodation → Holiday Parks 1024 Accommodation → Bungalows 1008 bungalow 687 map 801 member 10154 De Fryske Marren → Lemmer 1188
skriuwerij-liderke.nlSkriuwerij LiderkeSkriuwerij Liderke is a website offering various products and services, including photo books, calendars, posters, and exhibitions.Image Products → Photo Books 16 Arts & Culture → Art Education 594 stem 43 photo book 135 bird 922 poem 1014 calendar 1556 exhibition 5332 De Fryske Marren → Lemmer 1188
u2drive.nlU2DriveU2Drive is a driving school located in Lemmer that offers driver's licenses for cars and motorcycles.Higher Learning → Exam Preparation 117 traffic situation 19 driving lesson 712 motivation 894 license 1288 lesson 5154 De Fryske Marren → Lemmer 1188
vanberkum-hoveniers.nlVan Berkum HoveniersVan Berkum Hoveniers is a landscaping company that provides garden design, installation, maintenance, and pergolas.Landscaping → Garden Installation 617 Building & Materials → Paving Materials 28 pergola 492 fence 1814 paving 1942 garden 13129 maintenance 20093 design 27202 De Fryske Marren → Harich 35
aalbertsdoet.nlAalberts DoetThis website showcases the services and experience of Esther Aalberts, a consultant and project manager specializing in information management, digital communication, and information security within the public sector.Data Analysis → Business Intelligence 1002 Government & Administration → Public Sector 319 information management 144 data analysis 211 information security 217 project management 3423 communication 10162 Friesland → Leeuwarden 6068
happyescortfriesland.nlHappy Escort FrieslandThe website is an escort agency offering Dutch escort girls in Friesland and surrounding provinces.Adult Content → Escort Services 96 Transportation → Travel Services 122 escort service 11 order 6912 De Fryske Marren → Joure 689
dkd-lasopleidingen.nlDKD LasopleidingenDKD Lasopleidingen Joure offers welding training, certification for welders and companies, and welding advice.Machine Shops & Welding → Welding Technology 115 Business & Management → Certification 364 welding training 10 certification 3380 De Fryske Marren → Joure 689
hwf.nlHWFHWF is a medical practitioners' organization that collaborates with doctors in West Friesland and Wieringermeer to promote high-quality and accessible care.Medical Care & Services → Primary Care 5699 doctor 1397 region 5412 practice 9089 care 12338 collaboration 16036 De Fryske Marren → Lemmer 1188
pizzeriadelizia.nlPizzeria DeliziaPizzeria Delizia's website serves as an online platform to display the menu, accept online orders, and inform customers about the service and contact details.Meal Solutions → Delivery Service 80 pizzeria 76 delivery service 236 menu 13856 De Fryske Marren → Lemmer 1188
haskerpoort.nlCrematorium HaskerpoortCrematorium Haskerpoort provides a space for grieving individuals to arrange a personal farewell, emphasizing support and sustainability.Trauma & Recovery → Grief 907 Funeral Services → Cremation 43 meadow 75 remembrance 165 cremation 615 farewell 1109 flowers 3248 De Fryske Marren → Oudehaske 49
igrotech.nlIgrotech InstallatietechniekIgrotech Installatietechniek is an installation company based in Heeg offering a wide range of plumbing and installation services.Heating → Boilers 336 boiler 1240 electrical 1414 plumbing 1761 air conditioning 2178 heat 2188 solar panels 4701 Southwest-Friesland → Heeg 227
cafetariadebrege.nlCafetaria de BregeThe website of Cafetaria de Brege presents the menu, opening hours, and job vacancies of the cafeteria, and offers the possibility to order online.Fast Food → Fries 949 Jobs → Vacancies 1099 cafeteria 169 opening hours 2953 vacancy 6598 order 6912 menu 13856 De Fryske Marren → Delfstrahuizen 47
annemarijesbeautysalon.nlAnnemarije's BeautysalonAnnemarije's Beautysalon is a salon offering a wide range of skincare products, makeup, and treatments, with a focus on personalized skincare advice and result-oriented routines.Eyelash Services → Eyebrows 777 Beauty → Makeup 1248 eyebrows 1127 makeup 1477 skincare 1972 salon 5541 treatment 21203 De Fryske Marren → Lemmer 1188
bloemisterijdeswanneblom.nlDe Swanneblom BloemenDe Swanneblom Bloemen is a flower shop offering flowers and floral arrangements for various occasions, with a particular focus on funeral flowers and wedding flowers.Florists → Online Flower Shops 293 Online Retail → Gift Certificates 225 bridal bouquet 47 funeral flowers 199 floral arrangement 344 online shop 1310 flowers 3248 De Fryske Marren → Joure 689
italianflair.nlItalian FlairThe website showcases the services of Italian Flair, particularly concerning bridal styling, makeup, and other beauty services, and offers contact and booking options.Weddings → Bridal Styling 154 Beauty → Makeup 1248 makeup 1477 styling 2331 wedding 4258 Leiden → Oude Morsch 19
vakantiepark-friesland.nlVakantiepark FrieslandThe website is a holiday park offering accommodations and vacation packages in the Netherlands, with a focus on Friesland.Accommodation → Holiday Parks 1024 Tourism → Holidays 1086 holiday park 566 accommodation 4921 region 5412 account 5781 package 6112 blog 13392 Ooststellingwerf → Appelscha 331
refocus-cc.nlRefocus Coaching & ConsultancyRefocus - Coaching & Consultancy is a website offering life coaching and consultancy services in the West Friesland region, aiming to help individuals and organizations achieve personal and professional growth.Self-Help → Life Questions 824 Spirituality → Parapsychology 41 life coach 49 choice 827 question 2261 consultancy 2596 balance 4582 coach 25810 De Fryske Marren → Lemmer 1188
zakelijkuit.nlBedrijfsuitje.nlThe website provides event organization services for corporate outings and themed events, focusing on original and customized solutions.Family Activities → Outings 763 Corporate Events → Corporate Outings 878 corporate outing 388 outing 982 destination 2580 theme 4015 event 45199 Raalte → Luttenberg 532
dujob.nlDujobDujob is a job board that assists job seekers in the regions of Flevoland, South Friesland, Overijssel, North Gelderland, and South Drenthe in finding jobs in the fields of technology, industry, metalworking, and logistics.Online Services → Job Boards 1036 Business → Industry 36977 jobseeker 300 job 2795 vacancy 6598 training 28133 De Fryske Marren → Balk 224
familiearrangement.nlFamilieUitjes BVThe website offers information and booking options for various family outings and packages.Outings → Family Outings 34 family package 17 family outing 25 outing 982 destination 2580 reviews 3172 Raalte → Luttenberg 532
meerdaagsvergaderen.nlMeerdaags vergaderen .nlThe website 'Meerdaags vergaderen.nl' offers multi-day meeting arrangements in various locations throughout the Netherlands.Conferences & Meetings → Meeting Locations 171 Conferences & Meetings → Meetings 295 reviews 3172 Drimmelen → Made 335
gezinsuitje.nlGezins Uitje B.V.The website offers a platform to search and book family outings.Outings → Family Outings 34 Law → Family 2909 outing 982 destination 2580 arrangement 3104 restaurant 11215 Zevenaar → Lathum 89
rsp-recreatiebouw.nlRSP RecreatiebouwThe website of RSP Recreatiebouw presents their company, which has been manufacturing and delivering mobile homes, chalets, and other recreational buildings for 65 years. The website also provides information on available locations for placing the homes and financing options.Recreational Vehicles → Caravans 820 Property → Recreational Property 87 recreational home 67 mobile home 90 care home 130 finance 5341 Barneveld → Stroe 134
installatiebedrijfkopen.nlTechniek NederlandInstallatiebedrijfkopen.nl is a platform where installation companies can advertise and search for other installation companies for sale or rent.Bathroom → Sanitary Ware 845 International Trade → Export 674 turnover 83 installation company 100 province 518 sanitary 750 electrical engineering 817 advertisement 1707 Katwijk → Katwijk aan Zee 616
hettweededeel.nlHet Tweede DeelHet Tweede Deel is a webshop offering vintage items, curiosa, antiques, and other unique objects.Antiques & Collectibles → Vintage 623 Monuments → Heritage 526 objects 426 antique 432 vintage 689 ceramics 1271 furniture 8751 De Fryske Marren → Echten 54
schoonenkhuizen.nlSchoon EnkhuizenSchoon Enkhuizen is a community initiative focused on cleaning up litter in Enkhuizen through regular walks.Social Organization → Volunteering 2051 Waste Management → Litter 28 litter 414 initiative 1297 awareness 1735 walk 2161 community 7931 volunteer 8367 De Fryske Marren → Lemmer 1188
indefamilietuin.nlIn de FamilietuinIn the Familietuin is an initiative that provides a sustainable and inspiring place for day care and meetings.Farms & Farm Businesses → Care Farms 473 Early Years → Childcare 6029 dementia 674 meetings 1011 daycare 1365 nature 9094 care 12338 garden 13129 De Fryske Marren → Lemmer 1188
vwpnldoet.nlVWP NLDoetThe website VWP NLDoet provides information about volunteering opportunities in the West Friesland region, specifically within the Intermaris Doet initiative.Social Organization → Volunteering 2051 task 1507 volunteer 8367 De Fryske Marren → Lemmer 1188
nbvwestfriesland.nlNBV West-FrieslandThe website of the West-Friesland Bee Cultivation Association provides information about the association, its activities, member benefits, and news.Insects → Bees 116 Environment → Conservation 328 beekeeping 91 bees 373 honey 432 association 8562 member 10154 event 45199 De Fryske Marren → Lemmer 1188
frieslandmariteam.nlFriesland MariteamFriesland Mariteam is a company specializing in technical installations for yachts and ships.Maritime → Shipbuilding 568 Transportation → Marine & Watercraft 2309 yacht building 18 sanitary installation 31 shipbuilding 148 electrical installation 264 De Fryske Marren → Lemmer 1188
houtenhuismanboten.nlVereniging Eigenaren Houten HuismanbotenThe website of the Vereniging Eigenaren Houten Huismanboten (VEHH) serves as an information source and platform for members and stakeholders regarding the historical wooden boats built by the Huisman shipyard.Associations → Regional Associations 292 Water → Boats 935 alv 79 shipyard 130 reunion 267 boat 2980 association 8562 member 10154 Southwest-Friesland → Heeg 227
makelaaroverzicht.nlHuisVerkopen.nlThe website provides an overview of real estate agents in the Netherlands and information about selling and buying houses.Property Valuation & Appraisal → Regional Real Estate Agents 454 Boats → Selling 20 buy 169 sell 230 agent 1253 valuation 2697 house 8121 Simpelveld → Bocholtz 70
suzuki4x4friesland.nlSuzuki 4x4 FrieslandThe Suzuki 4x4 Friesland website is an online platform that showcases photos and news regarding 4x4 events and activities in the Friesland region, particularly at locations like Rohel and Poelman.Running → Running Events 684 Nature & Outdoors → Outdoor 4031 4x4 54 terrain 73 weather 817 participation 1430 photo 7778 event 45199 Westerkwartier → Opende 86
obsdemeridiaan.nlBasisschool de MeridiaanBasisschool de Meridiaan is a primary school in Medemblik, West Friesland, that focuses on a safe and supportive learning environment where children learn and develop in a playful way.Local Communities → Villages 1005 Neighborhood Focus → Neighborhoods 1028 kanjerschool 14 theme 4015 health 6366 education 13471 De Fryske Marren → Lemmer 1188
greensalesbalk.nlGreenSales Balk B.V.GreenSales Balk is a garden center offering a wide variety of plants, trees, and gardening supplies, serving both professional landscapers and private customers with a focus on quality and expert advice.Garden Maintenance → Landscapers 287 Outdoor & Garden → Plant Stores 14 landscaper 146 nursery 926 inspiration 4081 plant 4509 assortment 7799 De Fryske Marren → Harich 35
baukebakker.nlbaukebakker.nlThis website is a personal page providing information about the author, his background, hobbies, and family.Personal Websites → Family 191 Personal → Biography 1003 ice hockey 45 childhood 56 parenthood 94 marriage 209 family 6462 De Fryske Marren → Lemmer 1188
darlingii-careersite.nlDarling Ingredients NLThe website provides a job listing for Darling Ingredients Netherlands and allows potential candidates to apply spontaneously or via a job alert.HR Services → Executive Search 737 function 221 position 875 employee 4429 sustainability 18451 Apeldoorn → Loenen 220
silleke.nlSillekeThe website of Silleke offers creative workshops for adults and children in Friesland and Groningen, focusing on a cozy and relaxing learning environment.Hobbies → Creative Hobbies 412 Painting → Abstract Painting 594 calligraphy 69 drawing 1101 creativity 2531 paint 8747 workshop 19325 De Fryske Marren → Joure 689
coobzeeman.nlCoob ZeemanThe website of Coob Zeeman presents her artwork as a marine painter and offers information about her biography, exhibitions, archive, and workshops.Painting → Watercolor 274 sketch 271 watercolor 369 atelier 1417 paintings 3907 Huizen → Bovenmaten 136
hjhreclame.nlHJH ReclameHJH Reclame is a advertising agency specializing in designing logos and providing custom advertising solutions.Design & Projects → Self-Employed Entrepreneurs 505 advertising 2302 work 3122 logo 4660 De Fryske Marren → Balk 224
vogelwachtbalk.nlVogelwacht BalkThe Vogelwacht Balk is an organization dedicated to the observation and conservation of birds, particularly raptors, barn owls, and meadow birds in the Balk and surrounding region.Nature → Ornithology 505 birdwatching 27 chicks 45 nest 140 bird 922 drone 936 De Fryske Marren → Balk 224
hsv-de-bears.nlHengelsport Vereniging De BearsThe website of Hengelsport Vereniging De Bears provides information about the fishing association, its activities, members, fishing waters, and the VISpas.Fishing → Fishing Clubs 190 vispas 27 fishing water 87 match 3471 association 8562 member 10154 De Fryske Marren → Balk 224
mantelzorggaasterlansleat.nlMantelzorg Gaasterlân-SleatThe website Mantelzorg Gaasterlân-Sleat is a platform for caregivers in the Gaasterlân-Sleat region, focused on providing support, activities, and organizing events.Social Organization → Welfare Organizations 173 visits 49 present 149 caregiver 1167 collaboration 16036 event 45199 De Fryske Marren → Balk 224
cv-tec.nlCV-tecThe website of CV-tec provides services for the repair, maintenance, and installation of calda(toestellen) and is active in West-Friesland.Heating → Boilers 336 Technical Services → Maintenance Companies 517 west-friesland 41 installation 13742 maintenance 20093 De Fryske Marren → Lemmer 1188
logopediejoure.nlLogopediepraktijk JoureThe Logopedie Joure website provides information about speech therapy services for various communication disorders, including stuttering, language problems, and preverbal disorders, and showcases the practice’s services.Childcare → Language Development 574 Learning Disabilities → Dyslexia 438 stuttering 71 play therapy 130 speech therapy 540 language 2016 communication 10162 treatment 21203 De Fryske Marren → Joure 689
lennalemmer.nlLennaLenna is an online restaurant where customers can order food from the menu and receive a free drink.Essential → Food 47999 points 612 pizza 4158 wine 4476 order 6912 menu 13856 De Fryske Marren → Lemmer 1188
dehealelemster.nlDe Heale LemsterThe website provides information and organization regarding the Heale Lemster and Lytse Heale, two half marathons held in Friesland.Competitions → Running Competitions 16 Running → Races 266 runner 126 marathon 192 sponsor 1159 route 3425 De Fryske Marren → Echten 54
opslag-friesland.nlOpslag FrieslandOpslag Friesland is a company offering storage space rentals, including heated storage boxes and garage boxes, to individuals and businesses in the Friesland region.Logistics → Storage 1170 garage box 138 storage box 157 warehouse 1027 move 1441 archive 2067 space 3846 De Fryske Marren → Lemmer 1188
verloskundeskarsterlan.nlVerloskundigenpraktijk SkarsterlânThe website of Verloskundigenpraktijk Skarsterlân in Joure provides information and services related to pregnancy, childbirth, and postpartum care.Doctors → Midwives 89 Pregnancy & Childbirth → Midwifery 619 lactation 10 postpartum care 236 ultrasound 769 childbirth 894 pregnancy 2739 De Fryske Marren → Joure 689
waterrijkwonen.nlWaterrijk Wonen MakelaarsWaterrijk Wonen Makelaars is a real estate agency specializing in waterfront properties in Friesland, Netherlands.Houses → Two-Story Houses 110 Property Location & Neighborhood → Property 695 waterfront 44 agency 944 valuation 2697 sale 5930 property 7406 blog 13392 Tytsjerksteradiel → Noardburgum 62
ewijkmakelaardij.nlEwijk MakelaarsEwijk Makelaars is a real estate agency specializing in property sales and purchases in West-Friesland, providing information and tips to potential buyers and renters.Property Finance → Purchase 493 Property Valuation & Appraisal → Regional Real Estate Agents 454 agent 1253 chalet 1264 mortgage 4564 security 6655 house 8121 renovation 13849 De Fryske Marren → Lemmer 1188
desluisjachtbouw.nlDe Sluis Jachtbouw B.V.De Sluis Jachtbouw B.V. is a company specializing in the design and construction of custom-built yachts.Maritime → Shipbuilding 568 Marine & Watercraft → Yachts 189 shipyard 130 yacht 647 steel 1177 aluminum 1197 boat 2980 De Fryske Marren → Lemmer 1188
fotogeaveenstra.nlFotogea VeenstraThe website offers photography courses and workshops covering landscape, flowers, animals, macro photography, and digital editing.Artistic Expression → Fine Art Photography 502 canvas 694 artwork 2248 horse 4337 photography 9503 course 14728 workshop 19325 Wassenaar → Duindigt 15
noisivoi.nlNoi si Voi FoundationThe Noi si Voi Foundation’s website aims to showcase their work, mission, and projects focused on young people with intellectual disabilities in Romania.Humanitarian Organizations → International Organizations 734 Social Issues & Welfare → Disability Services 949 intellectual disability 72 romania 72 donor 757 young people 1045 volunteer 8367 De Fryske Marren → Sint Nicolaasga 146
zwembadengids.nlZwembadgids.nlThe website zwembadgids.nl is an online directory that collects all swimming pools and swimming schools in the Netherlands.Business Marketing → Online Marketing 34 Garden → Swimming Pools 601 rating 217 benefits 369 swimming pool 1664 reviews 3172 registration 4366 Noordenveld → Norg 322
lingeriegids.nlLingeriewinkelgids B.V.The website lingeriegids.nl is a directory for all lingerie stores in the Netherlands. The goal is to help potential customers find lingerie stores in their area and to help lingerie stores increase their online visibility.Websites → Information Sites 174 Underwear → Lingerie 471 benefits 369 reviews 3172 Dronten → Swifterbant 217
kennelgids.nlKennelgids kennelgids.nlThe website provides a directory of kennels, animal pensions, animal shelters, and animal hotels in the Netherlands, including information such as reviews and opening hours.Animal Welfare → Animal Shelters 326 AccommodationTypes → Accommodation 12130 animal pension 19 animal shelter 78 place 242 kennel 513 reviews 3172 Teylingen → Voorhout 426
trendlabel28.nlTrendlabel28Trendlabel28 is a store that offers fashion and home accessories and provides a ‘one-stop-shop’ experience.Context 161394 home accessories 603 fashion 2212 collection 7566 clothing 9443 brand 17737 De Fryske Marren → Lemmer 1188
lapienorganizing.nlLapien OrganizingThe website of Lapien Organizing presents the services of a professional organizer, Mascha Lapien, who helps individuals and businesses with decluttering and organizing their home, work, and administration, and offers workshops and lectures.Organizations → Professional Organizing 49 Home → Decluttering 161 decluttering 197 testimonials 416 space 3846 administration 6587 workshop 19325 De Fryske Marren → Lemmer 1188
caravancentrumkarsten.nlCaravancentrum KarstenCaravancentrum Karsten is a company in North Holland specializing in the storage, sale, and maintenance of caravans, campers, folding campers, and boats.Recreational Vehicles → Caravans 820 Logistics → Storage 1170 servicecenter 380 caravan 1394 camper 1596 storage 2446 sale 5930 maintenance 20093 De Fryske Marren → Lemmer 1188
kooystrapro.nlKooystra ProfessioneelKooystra Professioneel is a company providing services and products for event technology, including livestreaming, installations, and rental of audio, lighting, and video equipment.Event Resources → Event Technology 259 Technology → Audiovisual & Media 688 livestream 478 audio 934 light 5148 video 6714 installation 13742 event 45199 De Fryske Marren → Joure 689
41club.nl41 Club NederlandThe website of 41 Club Nederland (also known as 41 International) is a platform for members of this international organization. It serves as an information center, news website, webshop and event calendar.Humanitarian Organizations → International Organizations 734 news 15293 De Fryske Marren → Lemmer 1188
kwispel-coaching.nlKwispelCoachingKwispelCoaching offers coaching services utilizing dogs as co-coaches, focusing on children, adolescents, and adults, and providing support in schools.Support → School Support 171 Family → Parents 525 behavior 1779 dog 5483 school 7856 coach 25810 De Fryske Marren → Lemmer 1188
botwooncentrum.nlBot Wooncentrum OpmeerBot Wooncentrum Opmeer is a furniture and interior goods store in the Hoorn, Heerhugowaard, and Schagen region, offering a wide selection of furniture and home décor.Living & Dining → Living Room Furniture 163 Furniture & Decor → Bedroom 1581 furniture store 24 interior advice 266 bedroom 2051 showroom 4883 collection 7566 furniture 8751 De Fryske Marren → Lemmer 1188
jointheproject.nlDe Jongeren Stichting Die Maatschappelijke Projecten OrganiseertThe website of De Jongeren Stichting Die Maatschappelijke Projecten Organiseert is focused on organizing social projects and supporting young people.Social Organization → Youth Organizations 1726 Initiatives & Projects → Local Initiatives 1001 council 426 young people 1045 idea 2367 collaboration 16036 De Fryske Marren → Lemmer 1188
pyro-outlet-joure.nlPyro Outlet JourePyro Outlet Joure is a firework shop that offers a wide selection of fireworks at outlet prices to residents of Joure and the surrounding area.Party Supplies → Fireworks 258 Parties → New Year’s Eve 71 cakeboxes 13 fountain 96 fireworks 413 box 1982 package 6112 De Fryske Marren → Joure 689
luxuryhomes.nlLuxuryhomesLuxuryhomes.nl is a website offering a platform for buying and renting luxury homes in the Netherlands and internationally, with a focus on attracting buyers in the higher segment.Automotive → Sales 1205 buyer 233 listings 525 partner 4272 rental 7257 property 7406 home 7976 Brummen → Eerbeek 328
bureaujenaplan.nlBureau JenaplanBureau Jenaplan provides guidance, training, and consultancy for Jenaplanscholen, primarily focused on achieving the Jenaplan diploma.Mental & Emotional Well-Being → Autism 958 Adult & Continuing Learning → Professional Development 2080 jenaplan 77 diploma 795 school 7856 course 14728 training 28133 De Fryske Marren → Echten 54
kok-info.nlKok Bouwkundige BeveiligingKok Bouwkundige Beveiliging is a recognized specialist in security solutions, including burglary prevention, repairs, and the sale of security products, for individuals and businesses in West Friesland.Repair → Lock Repair 266 Security → Locks 291 adjustment 114 burglary 211 keys 370 locksmith 919 locks 953 security 6655 Hollands Kroon → Wieringerwerf 197
vidravastgoed.nlVidra VastgoedVidra Vastgoed is a real estate agency located in Hoorn offering services related to the sale, purchase, valuation, and rental of real estate.Property Agents & Brokers → NVM Real Estate Agents 105 broker 902 valuation 2697 real estate 4981 house 8121 De Fryske Marren → Lemmer 1188
bouwtechnokracht.nlBouw TechnokrachtBouw Technokracht is a recruitment agency specializing in the placement and training of personnel in the construction and technical sectors.HR Services → Technical Recruitment 474 Recruitment → Personnel Services 162 personnel 1084 candidate 1896 job 2795 vacancy 6598 training 28133 De Fryske Marren → Lemmer 1188
akkerman-mechan.nlAkkerman MechanThe website of Akkerman Mechan offers a wide selection of new and used tractors and machinery, and provides services such as workshop appointments, brand recommendations, and news about events.Machinery & Repair → Tractors 266 Trade → Agricultural Trade 97 machinery 519 tractor 789 stock 1154 news 15293 brand 17737 workshop 19325 Leusden → Achterveld 177
roelofspeelman.nlRoelof SpeelmanThis website is a personal reflection by Roelof Speelman, a man who, after a life of experiences and challenges, now lives a nomadic life in a camper with his partner.TravelStyles → Nomadic Travel 15 freedom 848 camper 1596 creativity 2531 life 2673 partner 4272 travel 7210 De Fryske Marren → Scharsterbrug 16
frankmeesterfotografie.nlFotograaf Frank MeesterThe website of Fotograaf Friesland showcases the services of Frank Meester, a photographer specializing in business photography, studio photography, and lifestyle photography, with a focus on relaxed and authentic photographs.Commercial Work → Commercial Photography 731 corporate report 18 business photography 104 photoshoot 1018 photographer 1366 portfolio 6854 De Fryske Marren → Joure 689
osteopathietexel.nlosteopathietexel.nlThe website compares the costs and quality of osteopaths in various regions of the Netherlands.Physical Therapy → Osteopathy 922 TravelContent → Maps 141 osteopath 22 cost 1990 treatment 21203 Pijnacker-Nootdorp → Pijnacker 788
coach-psycholoog.nlHenrike Coach & PsychologistThe website of Henrike Coach & Psychologist offers personal coaching and therapy in Friesland, specializing in EMDR and online therapy, aimed at improving balance, resilience, and discovering potential.Psychotherapy → Cognitive Behavioral Therapy 164 emdr 549 resilience 1091 problem 2214 balance 4582 therapy 7448 coach 25810 De Fryske Marren → Balk 224
follow4you.nlFollow4youThe Follow4you website offers horse coaching services for young adults and adults, focused on personal development and well-being through interaction with a horse.Horses → Horse Care 488 Therapy → Alternative Therapies 865 horse coaching 129 wellbeing 2620 stress 3965 growth 4054 horse 4337 De Fryske Marren → Nijemirdum 19
grootewijzend.nlMinicamping de Groote WijzendThe Minicamping de Groote Wijzend website showcases a campsite with safari tents and boat rentals in Lutjebroek, West Friesland, focusing on weekend getaways, vacations, and group accommodations.Campsites → Luxury Campsites 28 Accommodation → Group Accommodation 844 group room 21 boat rental 124 safari tent 128 campsite 2093 De Fryske Marren → Lemmer 1188
wennemars.nlWennemarsThe website of Wennemars presents calf drinking systems, feed mixers and related services, with a focus on sustainable dairy farming and the improvement of the health and performance of livestock.Livestock → Dairy Farming 671 Livestock → Calf Farming 10 De Fryske Marren → Oosterzee 29
fysioinbalans.nlFysiotherapie In BalansFysiotherapie In Balans is a physiotherapy practice located in Lemmer, offering services to help people regain mobility and address physical issues.Physical Therapy → Chiropractic 420 core stability 11 physical complaints 49 rehabilitation 1512 De Fryske Marren → Lemmer 1188
ovengevormdglas.nlEMMA-designThe website presents the archives of previous editions of the international glass art exhibition 'Kilnformed Glass', including information about participating artists and exhibitions.Decorative Arts & Crafts → Glass Art 128 exhibition 5332 artist 5745 De Fryske Marren → Langweer 93
sbopalet.nlSBO 't PaletThe website of SBO 't Palet serves as an information source for parents, students, and interested parties regarding the school, its goals, and offerings.Social Organization → Children’s Organizations 467 pedagogical 159 document 1678 parent 4318 student 7623 school 7856 De Fryske Marren → Lemmer 1188
112-water.nl112-WaterThe website 112-water.nl provides water rescue and assistance in Friesland, 24/7, through various locations and a rescue boat.Water → Boating 1592 safety 5819 Southwest-Friesland → Koudum 134
beerepootinstallatietechniek.nlBeerepoot Installatietechniek b.v.Beerepoot Installatietechniek is an electrical installation company offering a variety of services including advice, design, and maintenance of installations.Building Systems & Services → Mechanical Installation 80 security 6655 energy 9075 installation 13742 maintenance 20093 De Fryske Marren → Lemmer 1188
tandzorgstnyk.nlTandzorg St.NykThe website of Tandzorg St.Nyk is an online portal for the dental practice in Sint Nicolaasga, offering a range of dental treatments and providing information about the practice, appointments, fees, and contact details.Dentistry → Pediatric Dentistry 441 dental practice 181 oral health 686 appointment 13510 treatment 21203 De Fryske Marren → Sint Nicolaasga 146
fysiodemerk.nlFysiotherapiepraktijk de MerkFysiotherapiepraktijk de Merk provides physiotherapy and preventative care with the goal of improving patients’ mobility and preventing future complaints.Physiotherapy → Sports Physiotherapy 747 Body & Movement → Preventative Care 344 mobility 1264 rehabilitation 1512 prevention 1763 physiotherapy 4688 complaint 6479 De Fryske Marren → Joure 689
notarisjoure.nlGroenewegen NotarissenThe website of Groenewegen Notarissen presents the takeover of the Harmsma Notarissen practice in Joure, continuing their role as a notary public in the Joure region and offering expert legal services to individuals and entrepreneurs.Notaries → Notary Office 82 files 290 notary 791 legal 937 De Fryske Marren → Joure 689
noudus.nlHotel NoudusHotel Noudus is a sustainable hotel and restaurant located in Friesland, offering unique stays and culinary experiences.European → Dutch 48 Accommodation → Breakfast 364 stay 702 room 3411 hotel 3543 restaurant 11215 sustainability 18451 De Fryske Marren → Delfstrahuizen 47
schipholtaxi-friesland.nlTaxibedrijf van ReekenTaxi de Jong Ee Eelde Friesland is a taxi company offering airport taxi services and taxi transfers to Schiphol and other airports in Friesland and surrounding areas.Taxi & Ride Services → Taxi 1062 Taxi & Ride Services → Airport Transportation 365 luxury 375 friesland 692 taxi 2090 rate 2606 De Fryske Marren → Joure 689
tandartssloten.nlTandarts SlotenTandarts Sloten is a dental practice offering a range of dental services with a focus on quality, personalized care, and emergency appointments.Dentistry → Dental Hygienist 651 dentist 2514 practice 9089 child 11566 appointment 13510 treatment 21203 Amsterdam → Sloten 146
mcwombarg.nlMCWombargThe website of MCWombarg is an online platform for members and potential members of a motorcycle club that offers rides, events, and club information.Motorcycling → Motorcycle Clubs 276 club night 47 clubhouse 784 ride 1075 history 7286 membership 10442 event 45199 De Fryske Marren → Lemmer 1188
yacht-power.nlYachtpower BVYachtpower is a company specializing in the supply, refit, and custom build of marine generators, propulsion systems, and air conditioning units.Engineering → Mechanical Engineering 737 Context → Transportation 39459 propulsion 15 refit 80 generators 96 engine 758 air conditioning 2178 De Fryske Marren → Joure 689
caatjeslekkernijen.nlCaatjes LekkernijenThe website of Caatjes Lekkernijen presents regional products from Twente, with a focus on healthy, homemade treats without additives.Dairy & Cheese → Delicacies 127 Food → Local & Regional Products 930 treat 373 regional products 391 event 45199 De Fryske Marren → Balk 224
mcwest-friesland.nlMC-West-FrieslandThe website of Motorclub West-Friesland serves as an information source and membership administration platform for the motorclub, featuring news, tour schedules, photos, and potentially advertisements.Motorcycling → Motorcycle Clubs 276 motorclub 55 photo 7778 membership 10442 news 15293 De Fryske Marren → Lemmer 1188
goedkopefietskopen.nlGoedkopefietskopen.nlThe website provides an overview of affordable bicycles and facilitates comparing different suppliers.Bicycles & Wheels → Bicycles 1466 bike 1541 supplier 1725 bicycle 2838 route 3425 model 3546 price 8328 Amsterdam → East 1423
zwartbv.nlAannemersbedrijf Zwart b.v.Aannemersbedrijf Zwart b.v. is a construction company based in Amsterdam and West-Friesland specializing in foundation repair and other construction services.Renovation → Extensions 651 foundation repair 24 wishes 2717 construction 7421 De Fryske Marren → Lemmer 1188
makelaardijhofstee.nlMakelaardij HofsteeThe website of Makelaardij Hofstee presents an offer of residential and commercial real estate services in South Friesland and the Kop of Overijssel, focusing on sales and appraisals.Property Sales → For Sale Properties 95 Property Valuation & Appraisal → Residential Appraisal 622 funda 43 appraisal 1488 sale 5930 house 8121 De Fryske Marren → Balk 224
wolvehoeve.nlDe WolvehoeveDe Wolvehoeve is a pet boarding facility that provides vacation care for dogs and cats.Animal Welfare → Animal Boarding 58 TravelStyles → Traveling With Pets 20 pet boarding 16 vaccination 494 cat 1578 vacation 4234 inspection 4279 dog 5483 De Fryske Marren → Joure 689
bergsmajoure.nlAutobedrijf BergsmaThe website of Autobedrijf Bergsma presents the car dealership and its activities, including used cars and a Bovag workshop, and informs about the transition to a carwash and washboxes.Maintenance & Services → Car Wash 495 Fuel & Energy → Gas Stations 249 washbox 66 car dealership 142 car wash 352 used cars 894 workshop 19325 De Fryske Marren → Joure 689
badminton-medemblik.nlBadminton Vereniging PoonaThe website of Badminton Vereniging Poona provides information about the club, its board members, activities, and rules.Sports Clubs → Table Tennis 495 Combat → Badminton 702 season 692 De Fryske Marren → Lemmer 1188
radio8521.nlRadio 8521The Radio 8521 website is an online radio station serving the community of St.nyk and the surrounding area, offering a livestream, news, a ballot, and archive materials.Radio → Local Radio 291 Radio → Online Radio 509 preparation 160 radio station 218 livestream 478 news 15293 De Fryske Marren → Sint Nicolaasga 146
veenstrayachts.nlVeenstra YachtsVeenstra Yachts is a yacht brokerage firm offering comprehensive yacht brokering services and selling used yachts of various types.Marine & Watercraft → Yachts 189 Marine & Watercraft → Yachting 39 marina 487 yacht 647 broker 902 boat 2980 De Fryske Marren → Terherne 98
krachtstek.nlKrachtstekKrachtstek is an inspiring location in West Friesland offering various activities and arrangements for workshops, lectures, corporate outings and events.Garden → Nature Gardens 10 Tea & Coffee → Tea Houses 42 tea house 73 arrangement 3104 space 3846 workshop 19325 event 45199 De Fryske Marren → Lemmer 1188
jonkman-administratie.nlR.S. Jonkman AdministratieThe website of R.S. Jonkman Administratie offers various administrative, consultancy and advisory services targeted at startups, SMEs, individuals, and large companies.Accounting → General Accounting 939 Freelance & Independent → Freelancer Support 14 bookkeeper 80 customer base 171 consulting 3639 account 5781 De Fryske Marren → Sint Nicolaasga 146
regiovastgoedmakelaars.nlRegio VastgoedmakelaarsRegio Vastgoedmakelaars is a real estate brokerage firm offering services for the sale, rental, and management of real estate.Real Estate → Property Valuation & Appraisal 2123 Real Estate → Property Agents & Brokers 1366 inspection 4279 sale 5930 insurance 6359 rental 7257 property 7406 De Fryske Marren → Joure 689
zweedshome.nlZweedshomeZweedshome is a company specializing in the design, construction, and sale of Swedish-style homes, emphasizing sustainability and customization.Houses → Wooden Houses 13 Web Design → Website Builders 888 brochure 1642 customization 1723 wood 4153 home 7976 sustainability 18451 Lansingerland → Berkel and Rodenrijs 929
keukensenzolemmer.nlKeukens & Zo LemmerKeukens & Zo Lemmer is a local kitchen advice and design company that helps customers realize their dream kitchen.Kitchen → Kitchen Advice 11 Kitchen → Kitchen Design 443 showroom 4883 kitchen 6443 family 6462 design 27202 De Fryske Marren → Lemmer 1188
volkstuinjoure.nlVolkstuinvereniging Voor Nut en OntspanningThe volkstuinjoure.nl website promotes gardening in Joure by offering plots for rent in community gardens and private gardens, providing information and rules for gardening.Community Gardens → Garden Associations 36 Gardening → Allotments 115 food bank 216 plot 1051 garden 13129 event 45199 De Fryske Marren → Joure 689
dirtydogband.nlDirty DogThe website of Dirty Dog presents information about the band, its performances, a video, and a gallery of photos.Live Entertainment → Music Performances 265 Performance → Live Performances 60 musician 1207 gallery 1983 band 2977 video 6714 performance 7586 De Wolden → Ruinen 188
groepsaccommodatie-friesland.nlGroepsaccommodatie FrieslandThe website provides information and online booking options for group accommodations in Friesland.Accommodation → Group Accommodation 844 Nature → Natural Areas 257 hot tub 260 site 422 outing 982 sauna 1175 accommodation 4921 family 6462 Southwest-Friesland → Sneek 1921
schoolschakenwf.nlSchoolschaken West-FrieslandThe Schoolschaken West-Friesland website provides information about the schools chess competition in West-Friesland, including results, registrations, and details about events such as the semi-finals and finals.Games → Card Games 503 Curriculum & Resources → General Education 44 chess 216 points 612 competition 4759 De Fryske Marren → Lemmer 1188
lujongyoga.nlLu Jong YogaThis website provides information about Lu Jong Yoga, a Tibetan yoga form aimed at promoting health and well-being by balancing the body and mind.Mind & Body → Stress Relief 75 exercises 1058 balance 4582 energy 9075 workshop 19325 De Fryske Marren → Balk 224
monicabeers.nlUitvaartverzorging Monica BeersThe website of Uitvaartverzorging Monica Beers offers funeral care with a personal touch in Hoorn and West-Friesland, providing services such as arranging the funeral, reporting the death, and offering various funeral products.Funeral Services → Funeral Arrangement 486 Essential → Home 70708 death 356 farewell 1109 grief 1577 funeral 2477 De Fryske Marren → Lemmer 1188
vuurwerk-outlet.nlVuurwerk OutletVuurwerk Outlet is a company that sells fireworks at outlet prices.Party Supplies → Fireworks 258 outlet 235 fireworks 413 store 3901 assortment 7799 price 8328 Pijnacker-Nootdorp → Pijnacker 788
totkraals.nlTotKraalsTotKraals is a company that offers creative workshops, children’s parties, scavenger hunts, and party packages.Outdoor Activities → Nature Activities 78 Parties → Birthday Parties 1008 scavenger hunt 88 party 5928 package 6112 workshop 19325 De Fryske Marren → Lemmer 1188
doorzorg.nlDoorzorgDoorzorg is a bureau providing personalized ergotherapy guidance and case management to former cancer patients in West Friesland.Rehabilitation → Ergotherapy 223 Diseases → Cancer 546 care provider 100 case management 105 ergotherapy 221 cancer 631 De Fryske Marren → Lemmer 1188
naturologic.nlNaturologicNaturologic provides services for equestrian sports, focusing on both the riding performance and health of horses, utilizing a holistic approach.Animal & Veterinary → Horse Health 87 holistic 699 horse 4337 therapy 7448 training 28133
gerardjouwhypotheekadviseur.nlGerard jouw HypotheekadviseurThe website provides independent mortgage advice to individuals and entrepreneurs in the Heerenveen area.Financial Services → Entrepreneur Advice 62 bank 374 plan 2566 mortgage 4564 property 7406 Heerenveen → Akkrum 246
mandjesenzo.nlMandjesenzo.nlThe Mandjesenzo.nl website offers colorful, handmade wicker baskets for sale, primarily at markets. Anneke sells the baskets and provides customers with the opportunity to contact her for orders that are not yet sold.Local Events → Markets 1097 Crafts → Handmade 1147 handmade 270 basket 275 map 801 facebook 850 instagram 1216 market 2772 Southwest-Friesland → Workum 363
structuurwijzer.nlStructuurWijzer Sandra Schouwenaars financieel professionalThe website of StructuurWijzer Sandra Schouwenaars is a professional website of a financial advisor who helps companies with project administration, subsidy applications, and compliance with regulations.Business Software → Accounting Software 984 Administration → Secretarial Services 851 project administration 18 overview 329 compliance 506 subsidy 2649 administration 6587 De Fryske Marren → Lemmer 1188
bandenoutletlemmer.nlAuto and motor Banden Specialist & Outlet LemmerThe website aims to provide tire services, wheel repair and air conditioning service to individuals and businesses in the Lemmer area.Tires → Tire Service 931 Auto Parts & Tires → Wheels 545 alignment 199 wheel 746 tire 1975 air conditioning 2178 car 10865 repair 14576 De Fryske Marren → Lemmer 1188
clarisajeelof.nlArtWorlds en Museum de FundatieThe website showcases exhibitions and events featuring the artwork of Clarisa Jeelof and other artists.Galleries & Exhibitions → Exhibitions 1083 landscape 2609 art 3856 exhibition 5332 studio 5465 artist 5745 Opsterland → Hemrik 35
corsoitaliano.nlCorso ItalianoCorso Italiano offers Italian language courses in West-Friesland and Enkhuizen, both in person and online, catering to various levels and purposes.Modern Languages → Italian 94 Training → Language Training 132 italian 320 teacher 2890 lesson 5154 course 14728 De Fryske Marren → Lemmer 1188
hartjemokum.nlhartjemokum.nlThe website Hartje Jolijt is an online collection of stories, poems, and historical information related to the personalities of Aafje Heynis and Majoor Bosshardt, and the history of ‘heartjes’ – small, flavorful drinks with unique names – produced in Amsterdam and surrounding areas, with a focus on the nostalgic atmosphere of the Golden Age and life on the Wallen.Dutch History → Golden Age 16 National Identity → Dutch Culture 57 poem 1014 recipe 5142 story 8285 De Fryske Marren → Joure 689
wilmainterieur.nlWilma InterieurThe website of Wilma Interieur offers interior design, advice, guidance, and styling services aimed at helping customers transform their homes and create a personalized living style.Interior Design → Interior Decorating 68 styling 2331 studio 5465 interior 8093 design 27202 De Fryske Marren → Lemmer 1188
haarwerkendominique.nlHaarwerken DominiqueHaarwerken Dominique is a Hairwear Specialist that provides custom-made hairpieces and supports customers with the fitting, selection, and use of hairpieces.Cancer → Chemotherapy 11 Crafts → Textiles 1280 hairpiece 153 personal attention 194 fit 353 De Fryske Marren → Lemmer 1188
swfr.nlSkeelerclub West-Friesland RoltThe website of the Skeelerclub West-Friesland Rolt (SWFR) is an information source about the club, its activities, membership, and events within West-Friesland.Ice Rinks → Ice Skating Clubs 218 west-friesland 41 membership 10442 training 28133 event 45199 De Fryske Marren → Lemmer 1188
makelaardijvanengelenburg.nlMakelaardij van EngelenburgMakelaardij van Engelenburg is a real estate agency focused on the sale and purchase of homes in Friesland.Property Finance → Purchase 493 Real Estate → Property Valuation & Appraisal 2123 appraisal 1488 purchase 2212 sale 5930 house 8121 network 11123 De Fryske Marren → Lemmer 1188
bodystressreleasewf.nlIvonDeeThe BSR Practice website provides information about Body Stress Release (BSR), a manual therapy technique focused on releasing muscle tension and stimulating the body's self-healing abilities.Physical Therapy → Pain Therapy 936 Alternative Medicine → Shiatsu 830 bsr 28 muscle tension 62 self-healing 158 muscle 498 symptoms 558 technique 2157 De Fryske Marren → Lemmer 1188
willemwierda.nlWillem WierdaWillem Wierda is a specialist in the supply of verandas, sunrooms and carports.Outdoor Living → Verandas 497 verasol 14 sunroom 96 carport 248 shading 364 veranda 1055 Noordoostpolder → Emmeloord 1649
rkstucadoors.nlRK StucadoorsThe website of RK Stucadoors presents the services of a stucadoor (plasterer) specializing in various wall finishes and repairs in West-Friesland.Construction Companies → Plasterers 843 Plastering & Rendering → Stucco 210 cornices 14 latex 195 plaster 2175 quote 12863 De Fryske Marren → Lemmer 1188
wbeg.nlWorking Group for the Promotion of Evolutionary MedicineThe website of the Working Group for the Promotion of Evolutionary Medicine connects researchers and enthusiasts who are involved in promoting health through the principles of evolutionary medicine.Allergies → Food Allergies 13 epigenetics 20 environment 4873 research 8967 De Fryske Marren → Balk 224
gezond-medemblik.nlGezond MedemblikGezond Medemblik is a multidisciplinary healthcare practice in Medemblik that offers a range of specialties under one roof, focusing on providing personalized and appropriate care to clients.Rehabilitation → Occupational Therapy 380 Primary Care → Health Centers 409 dietetics 197 occupational therapy 211 psychology 777 acupuncture 1537 physiotherapy 4688 nutrition 4935 De Fryske Marren → Lemmer 1188
deherberch.nlDe HerberchThe website of De Herberch presents a new apartment complex located in the historic center of Balk and provides information for potential buyers and interested parties.Apartment Living → For Sale 1007 facility 2616 apartment 5088 shop 6483 De Fryske Marren → Balk 224
webshop-sarifairfashion.nlSari Fair FashionThis website is the online webshop of sari fair fashion, a store specializing in fair fashion, sustainable clothing, and accessories with locations in Dalfsen and Joure.Fashion → Clothing 8067 Context 161394 store 3901 clothing 9443 accessories 12975 De Fryske Marren → Joure 689
atelier007.nlAtelier 007Atelier 007 is an architecture firm specializing in new construction projects, renovations, and the design of extensions, primarily for private clients.Project & Custom Work → Furniture Design 26 Renovation → Extensions 651 sketch 271 new construction 2672 renovation 13849 design 27202 Hof van Twente → Diepenheim 200
echopperverhuurbalk.nlE-chopperverhuurbalk.nlThe website E-chopperverhuurbalk.nl offers e-chopper rentals and tour opportunities in Friesland, with a focus on environmentally friendly riding and a nostalgic experience.Cycling → Bicycle Rental 643 Electric Vehicles → Electric Scooters 108 daf 51 solex 61 e-chopper 122 tour 2315 nature 9094 De Fryske Marren → Rijs 32
belshoftuin.nlErnest & Barbara Van Den BoezemThe website of De Belshof presents a garden, atelier, and shop offering art, ceramics, gardens and culinary experiences.Parks & Gardens → Garden 501 ceramics 1271 buffet 1747 art 3856 garden 13129 Utrecht → Veenendaal 2641
glasdingen.nlGlasdingenThe Glasdingen website showcases an atelier specializing in the creation of glass objects, including scales, vases, panels, and jewelry, through glass fusing and using a torch. The atelier also offers workshops and courses and provides an overview of past exhibitions.Crafts → Glassworking 581 Decorative Arts & Crafts → Glass Art 128 glass fusing 45 mold 356 atelier 1417 glass 2919 exhibition 5332 workshop 19325 Westland → De Lier 404
autotaalservicelemmer.nlAutotaalservice Lemmer B.V.The website of Autotaalservice Lemmer presents a wide range of automotive services, including maintenance, repairs, tire service, roadside assistance, and promotions, with an emphasis on reliability and Bosch quality.Auto Repair Services → General Repairs 44 Repair → Garage 1779 company vehicle 164 roadside assistance 211 automotive 283 tire 1975 repair 14576 maintenance 20093 De Fryske Marren → Lemmer 1188
zoutpoel.nlWaterpark de ZoutpoelThe Waterpark de Zoutpoel is a waterpark located in Friesland that provides information about its location, history, and facilities, and allows for contact.Neighborhood Organizations → Residents’ Associations 965 Water Sports → Water 2963 sneekermeer 14 waterpark 55 harbor 691 vve 748 plot 1051 Heerenveen → Akkrum 246
enkhuizenfm.nlRadio EnkhuizenThe website of Enkhuizen FM presents information about the relocation of the radio station to ‘Radio Enkhuizen’ and the shift from FM broadcasting to internet radio and potential DAB+ broadcasting.Radio → Local Radio 291 Radio & Communication → Radio 367 internet radio 15 dab+ 23 broadcasting 24 radio station 218 De Fryske Marren → Lemmer 1188
bellecorpo.nlBelle CorpoBelle Corpo is a practice offering various therapies, including foot reflexology, tuina, and hypnotherapy.Alternative Medicine → Shiatsu 830 Primary Care → Practices 780 tuina 127 foot reflexology 597 hypnotherapy 780 De Fryske Marren → Haskerhorne 14
deleyeruitersport.nlStal de LeyeStal de Leye is a specialist shop dedicated to Icelandic horses and equestrian sports.Pet Supplies → Horse Supplies 70 Animal Husbandry → Horse Keeping 128 blacksmith 60 pasture 191 fence 1814 horse 4337 lesson 5154 De Fryske Marren → Rijs 32
aasf.nlAnimalfood And Snacks Factory B.V.The website of Animalfood And Snacks Factory (AASF) presents the company as a producer of snacks and treats for dogs, cats, and small rodents, with over 15 years of experience.Animals → Pet Food 584 cat 1578 snack 2916 certification 3380 dog 5483 De Fryske Marren → Lemmer 1188
amvhoorn.nlAMV HoornThe AMV Hoorn website presents an administrative and accounting bureau that provides services to both businesses and individuals in Hoorn and West-friesland.Accounting → General Accounting 939 Government & Legal → Tax 1322 contact person 243 tax returns 423 account 5781 administration 6587 De Fryske Marren → Lemmer 1188
bedandbreakfastjoure.nlRocket Data (Joure)The website offers a bed & breakfast for sale in Joure, located in a unique and historic building.Providers → Domain Names 1466 Places → Towns 380 bed and breakfast 305 domain 1811 sale 5930 De Fryske Marren → Joure 689
bellaschilderenklusser.nlBella Schilder en KlusserBella Schilder en Klusser is a painting and handyman business located in Lemmer, offering various services including painting, handyman work, and wallpapering.Maintenance & Repair → Skilled Trades 220 Installation & Repair → Tradespeople 409 painter 740 handyman 836 paint 8747 quote 12863 De Fryske Marren → Lemmer 1188
heeren2.nlHeeren2The website of Heeren2 showcases a collection of furniture and decoration items, with a focus on diverse styles and a showroom in Balk, Friesland.Essential → Home 70708 decoration 4085 showroom 4883 newsletter 6504 collection 7566 interior 8093 furniture 8751 De Fryske Marren → Balk 224
hessinggoud.nlhessinggoudThe website compares the costs of goldsmith specialists in various regions of the Netherlands.Precious Metals → Gold 174 goldsmith 224 gold 805 cost 1990 region 5412 Sittard-Geleen → Munstergeleen 66
hoveniersbedrijfkoenraadvisser.nlHoveniers bedrijf Koenraad VisserThe Hoveniers bedrijf Koenraad Visser website provides services for garden design, landscaping, and maintenance.Garden Maintenance → Gardeners 685 Green Spaces → Green Maintenance 449 paving 1942 plant 4509 garden 13129 design 27202 De Fryske Marren → Lemmer 1188
zvvalphatours.nlZVV Alpha ToursThe website of ZVV Alpha Tours provides information about the hall football association, its teams, activities, news, and contact details. It serves as an information resource for members, potential members, and the wider community.Football → Hall Football 62 auction 561 match 3471 association 8562 membership 10442 news 15293 Drechterland → Venhuizen 154
velvetstables.nlVelvet StablesVelvet Stables is a breeding and training stable specializing in jumping horses, with a focus on breeding high-quality horses and training jumping horses.Animal Husbandry → Horse Farms 174 Equestrian → Jumping 35 mare 166 stallion 204 breed 1744 horse 4337 training 28133 De Fryske Marren → Lemmer 1188
autocenterzuiderbaan.nlAutocenter ZuiderbaanAutocenter Zuiderbaan is an established business in Southwest Friesland that deals with car sales and maintenance.Brand → Volvo 157 volvo 205 stock 1154 car 10865 De Fryske Marren → Balk 224
autolemmer.nlAuto LemmerThe Auto Lemmer website is an online presentation of an auto dealership and workshop in Lemmer, specializing in affordable gasoline cars and offering a delivery service with a guarantee.Used Cars → Occasions 257 Business → Business Services 115379 chiptuning 264 occasion 2036 part 5044 car 10865 workshop 19325 De Fryske Marren → Lemmer 1188
harmvandermolen.nlVan der Molen Bouw en OnderhoudVan der Molen Bouw en Onderhoud is a construction company located in Joure, Friesland, offering various construction and maintenance services.Construction Companies → Regional Construction Companies 152 construction company 824 skylight 966 extension 1941 window 2030 relationship 4205 floor 4781 De Fryske Marren → Joure 689
rayondedriesprong.nlRayon De DriesprongRayon De Driesprong is a post-duvet association consisting of three branches and provides information about their activities, results, and a guest book.News & Journalism → Regional News 948 Outdoor Activity → Pigeon Racing 203 friesland 692 results 3954 association 8562 De Fryske Marren → Terkaple 24
3oburo.nl3oBuroThe website describes the organization of meetings between students and companies in the region of South West Friesland and the Frisian Marches, with the goal of helping students explore career options and connecting entrepreneurs with potential future employees.Associations & Groups → Business Associations 1018 student 7623 education 13471 collaboration 16036 Friesland → Southwest-Friesland 4194
vanderavoirdbv.nlVan der Avoird BloembollenThe website of Van der Avoird Bloembollen presents the activities of a flower bulb company specializing in the cultivation of tulips, lilies, and onions, which has been in operation since 1955.Horticulture & Floristry → Flower Bulbs 22 cultivar 26 lily 50 onion 111 tulip 267 cultivation 481 De Fryske Marren → Lemmer 1188
vandalenmakelaardij.nlVan Dalen MakelaardijVan Dalen Makelaardij is a real estate agency focused on buying, selling, and valuing properties in the Sneek and Harlingen region.Property Advice & Guidance → Real Estate Advice 135 Real Estate → Agencies 243 listings 525 valuation 2697 mortgage 4564 property 7406 Southwest-Friesland → Sneek 1921
boersma-balk.nlBoersma BalkBoersma Balk is a company specializing in foundation technology and container transport, operating nationwide.Construction Technology → Foundation Technology 135 Transportation Services → Container Transportation 181 container transport 18 piles 34 container 1709 foundation 6678 De Fryske Marren → Balk 224
kapiteinpersoneel.nlKapitein & PersoneelKapitein & Personeel is a recruitment agency that helps professionals and companies find suitable jobs and personnel.Employment & Labor → Labor Market 580 Context 161394 agreement 1029 personnel 1084 job 2795 application 3377 employee 4429 De Fryske Marren → Lemmer 1188
ruudschreijer.nlRuud SchreijerThe website of Ruud Schreijer Driving School is a driving school offering driver’s lessons, motorcycle lessons and theory exams in the Hoorn and West-Friesland region, with a high passing rate and personalized instruction.Driving & Lessons → Motorcycle Lessons 351 Driver & Vehicle → Driver’s License 1625 pass rate 198 driving school 696 theory 956 exam 2120 instructor 3126 De Fryske Marren → Lemmer 1188
mondhygienistteplak.nlMondhygiënist te PlakThe website of Mondhygiënist te Plak presents the services of a dental hygienist in Lemmer, focused on preventative oral care and promoting a healthy mouth and teeth.Body & Movement → Preventative Care 344 Body & Movement → Oral Care 318 visit 380 dental hygienist 522 oral health 686 prevention 1763 practice 9089 Berg en Dal → Groesbeek 653
koopkorenfestival.nlStichting KoopkorenfestivalThe Koopkorenfestival Enkhuizen website provides information about the annual choral festival held in Enkhuizen, including dates, photos, and contact details.Genres → Jazz 989 Music & Performance → Music Events 758 photoclub 21 singer 860 choir 3123 festival 3804 music 13170 De Fryske Marren → Lemmer 1188
blankestijnenvantricht.nlPraktijk Blankestijn & Van TrichtThe website of Praktijk Blankestijn & Van Tricht offers relationship therapy, family therapy, and individual psychotherapy, primarily focused on the West Friesland region, and assists clients in overcoming stuck patterns in their relationships or personal lives.Therapy → Systemic Therapy 315 Context 161394 individual therapy 47 systemic therapy 52 family therapy 75 relationship therapy 501 burnout 1614 trauma 2107 Medemblik → Andijk 242
omniamakelaars.nlOmnia MakelaarsThe website Omnia Makelaars presents itself as a real estate agency operating in West-Friesland and offering services for the purchase and sale of real estate, including advice on renovations and insurance adjustments.Property Valuation & Appraisal → Regional Real Estate Agents 454 Caribbean Islands → Suriname 86 west-friesland 41 agent 1253 insurance 6359 house 8121 renovation 13849 De Fryske Marren → Lemmer 1188
autorijschool-thea.nlAutorijschool TheaThe website of Autorijschool Thea provides information about the driving school and its services in Bakhuizen and surrounding areas.Driver’s License → Theory 333 driving school 696 theory 956 driving lessons 2453 instructor 3126 training 28133 Southwest-Friesland → Sneek 1921
cmkmakelaars.nlCMK MakelaarsCMK Makelaars is a real estate agency based in Enkhuizen and West-Friesland, specializing in selling, buying, and valuing properties and offering them for rent.Real Estate → Agencies 243 rent 981 valuation 2697 real estate 4981 sale 5930 property 7406 Drechterland → Oosterwijzend 177
campingsaanhetwater.nlCampings aan het waterThe website provides an overview of campsites located by water, both in the Netherlands and internationally, with ratings and information on amenities.Water → Lakes 232 Water Activity → Swimming 1402 fishing 424 campsite 2093 water 2501 beach 3210 vacation 4234
hethaske.nlPSV 't HaskelânPSV ‘t Haskelân is a sports association that promotes sport, social involvement, and equestrian activities.Equestrian → Riding Clubs 245 arena 124 equestrian 138 competition 4759 association 8562 De Fryske Marren →  Sintjohannesga 24
verkeersschooldelange.nlVerkeersschool de LangeThe website of Verkeersschool de Lange offers driving lessons and courses for various driver's licenses in West-Friesland.Driver & Vehicle → Driver’s License 1625 driver's license 1283 driving lessons 2453 instructor 3126 safety 5819 student 7623 course 14728 Drechterland → Venhuizen 154
bouwcollectiefsneek.nlBouwCollectief Sneek bvBouwCollectief Sneek is a construction company that guides various building projects, from design to completion, for individuals, utilities, and businesses.Energy → Oil 114 Sustainable Building → Construction Projects 823 completion 126 specialist 938 partner 4272 construction 7421 design 27202 De Fryske Marren → Joure 689
mynextdestination.nlRTL4The website ‘My Next Destination’ provides an overview of travels and travel destinations featured in the RTL4 television program. The program presents various types of trips, from day trips to multi-day vacations, and highlights the diverse facets of travel.Regions → Europe 6764 camp 2466 destination 2580 travel 7210 Westerwolde → Bourtange 85
readyagain.nlReady Again LemmerReady Again Lemmer is a tennis club in Friesland that provides information to members about activities, competitions, news, and membership.Tennis → Tennis Clubs 720 padel court 172 tennis court 324 tennis club 337 tournament 2476 member 10154 De Fryske Marren → Lemmer 1188
huitemaschilders.nlHuitema SchildersHuitema Schilders Oudeschoot is a painting company with a long tradition and a focus on high-quality painting and related services.Personal & Household → Handyman Services 576 completion 126 approach 971 craftsmanship 1858 restoration 3417 paint 8747 De Fryske Marren → Tjerkgaast 16
fryslanbezorgd.nlN/AThe website, ‘Iten bestelle yn Fryslân,’ is a directory of restaurants in Friesland that offer delivery or take-away orders. It provides an overview of various eateries within the region.Fast Food → Döner 238 doner 131 kapsalon 509 sandwich 4098 pizza 4158 restaurant 11215 Achtkarspelen → Surhuisterveen 281
photobooth-westfriesland.nlPhotobooth West FrieslandThe Photobooth West Friesland website offers photobooth rental, party rental, and audio-visual services, primarily in West Friesland and North Holland. The website aims to facilitate the rental of complete event solutions.Wedding → Photo Booths 146 Event Styling & Decoration → Event Equipment 775 light letters 30 photo strip 36 props 122 party rental 124 photobooth 359 De Fryske Marren → Lemmer 1188
jobz-on.nlJobz-OnJobz-On is a recruitment agency based in Sneek, connecting job seekers and employers and offering various services, including staffing, temporary placement and career counseling.Context 161394 agency 944 employer 2383 job 2795 vacancy 6598 Southwest-Friesland → Sneek 1921
surfboy.nlSurfboy!The website of Julian Koldeweid is a platform for surfing, wingfoiling, and windsurfing, providing information on travel, lessons, and equipment.Windsurfing → Wingfoiling 17 wingfoiling 11 windsurfing 97 equipment 4143 travel 7210 De Fryske Marren → Mirns 22
iepenloftspulwijckel.nlIepenloftspul WijckelIepenloftspul Wijckel is an organization that will present an open-air musical, De Grutte Showman, in September 2026 in the Wijckelerbos.Music & Performance → Music Events 758 Outdoor & Recreation → Outdoor Performances 30 musical 510 performance 7586 De Fryske Marren → Wijckel 25
hondentrainingscentrumfriesland.nlHondentrainingscentrum FrieslandThe website of Hondentrainingscentrum Friesland offers courses, puppy courses, agility training, and dog walking services in the Friesland region.Dogs → Dog Activities 60 agility 170 trainer 1966 instructor 3126 dog 5483 therapy 7448 course 14728 Het Hogeland → Rottum 38
sexdatingcontact.nlsexdatingcontact.nlThe website sexdatingcontact.nl is an online dating platform that connects users with like-minded people in the hope of facilitating a meaningful relationship or adventurous encounters.Social Media → Dating 1644 encounter 78 date 1112 profile 1965 match 3471 relationship 4205 De Fryske Marren → Ruigahuizen 13
schirm.nlSchirm HerenkledingThe website of Schirm Herenkleding presents the history, services, and brands of a men’s clothing store that has been in operation since 1813.Clothing → Men’s Clothing 1008 Weddings → Wedding Dresses 266 custom tailoring 24 wedding suit 59 store 3901 clothing 9443 brand 17737 De Fryske Marren → Lemmer 1188
hetartiestenburo.nlThe ArtiestenburoThe Artiestenburo facilitates the online booking of artists and entertainment for events and festivals in the Netherlands.Recordings & Media → Singers 844 Local Events → Fairs 707 singer 860 artist 5745 event 45199 De Fryske Marren → Lemmer 1188
twafjilden.nlOBS De Twa Fjilden / AmbionOBS De Twa Fjilden is a school focused on creating a healthy and peaceful learning environment, with physical and mental health as a foundation.Primary Education → Islamic Schools 115 health 6366 student 7623 school 7856 education 13471 De Fryske Marren → Joure 689
bigglebaggle.nlBiggle Baggle BigbandThe website of the Biggle Baggle Bigband presents the band, its performances, and offers tickets for various concerts and events.Jazz → Big Band 104 bigband 122 musician 1207 repertoire 2497 concert 4409 performance 7586 De Fryske Marren → Lemmer 1188
jaarmarktstnyk.nlOrganisatiebureau Thomas09The website provides information about the annual St.Nyk market in Sint Nicolaasga, which traditionally takes place on the first Saturday of July.Local Events → Markets 1097 AccommodationTypes → Outdoors 224 oldtimer 93 market 2772 De Fryske Marren → Sint Nicolaasga 146
jeanettevenema.nlJeanette VenemaThe website of Jeanette Venema offers her services as a therapist and facilitator, focusing on body-oriented psychotherapy and supporting individuals in connecting with their own identity and potential.Therapy → Body-Oriented Therapy 437 Mental & Emotional Well-Being → Trauma 1001 body-oriented therapy 101 desire 196 setup 330 life 2673 training 28133 De Fryske Marren → Echten 54
viertaal-ambulantedienst-schagen.nlStichting VierTaalThe website of the Ambulante Dienst Regio NHN Schagen presents information about the support provided to students with communication and/or auditory impairments in mainstream education in the region of North Kennemerland, North Holland and West Friesland. The service specifically focuses on students with a Language Development Disorder (TOS), hearing loss (SH) and communication difficulties, as well as the involved parties.Special Needs & Support → Support 2006 service provider 225 registration 4366 student 7623 education 13471 course 14728 De Fryske Marren → Lemmer 1188
dierenartsenjoure.nlDierenkliniek IepensteinDierenkliniek Iepenstein Joure is a veterinary clinic offering a range of services for pets and horses.Hospital & Acute Services → Hospitals 735 Veterinarians → Veterinary Clinics 419 veterinary clinic 63 vaccination 494 pet 1617 horse 4337 De Fryske Marren → Joure 689
campingleenstra.nlCamping LeenstraCamping Leenstra is a small-scale campsite located in Teroele, Friesland, Netherlands, catering to watersport enthusiasts and guests seeking peace and nature.Boating → Marinas 825 Accommodation → Bungalows 1008 watersport 540 bungalow 687 friesland 692 cycle 1906 campsite 2093 nature 9094
kapsalonitboskje.nlKapsalon It BoskjeKapsalon It Boskje is a hair salon in Oudehaske offering various hair salon and scalp treatments, products, and a sun studio.Hair Education → Hair Products 612 Dermatology → Scalp Care 402 hair 3014 studio 5465 salon 5541 De Fryske Marren → Oudehaske 49
freelittlebirds.nlThe Lazy SundaysThe Lazy Sundays website provides information about the musical trio Free Little Birds, their concert schedule, and their debut album.Education & Training → Singing 878 Genres → Jazz 989 trio 83 sunday 208 album 1495 band 2977 concert 4409 music 13170 De Fryske Marren → Lemmer 1188
verkeersschooljanniekooystra.nlVerkeersschool Jannie KooystraVerkeersschool Jannie Kooystra offers driving lessons and theory courses in the Sint Nicolaasga area, including Idskenhuizen, Langweer, Tjerkgaast, and Joure.Driving & Lessons → Vehicles 541 cbr 172 driving school 696 driver's license 1283 driving lessons 2453 instructor 3126 De Fryske Marren → Sint Nicolaasga 146
autorijschoolschipper.nlAutorijschool SchipperThe website of Autorijschool Schipper is a driving school that offers driving lessons in West-Friesland, with the aim of helping students to obtain their driver's license.Driver & Vehicle → Driver’s License 1625 Driving & Vehicle → Vehicle Training 553 driving instructor 252 driver's license 1283 trial lesson 1433 exam 2120 driving lessons 2453 region 5412 De Fryske Marren → Lemmer 1188
vandeynenfysio.nlVan Deynen FysioVan Deynen Fysio is a physiotherapy practice offering various treatments, including manual therapy and sports massage.Massage → Sports Massage 641 Massage → Massage Clinics 329 lymphatic drainage 105 sport massage 630 manual therapy 1320 acupuncture 1537 physiotherapy 4688 De Fryske Marren → Terherne 98
verkeersschoolapex.nlVerkeersschool ApexVerkeersschool Apex is a driving school located in Joure.Driving & Vehicle → Vehicle License 62 lesson package 248 theory 956 driving lessons 2453 instructor 3126 practice 9089 De Fryske Marren → Joure 689
webdesignerwebsite.nlWebdesigner WebsiteThe website compares webdesign prices and helps users find a webdesigner in their area.Web Design → Themes 240 Online & Digital → Digital Services 1008 webdesigner 40 office 2898 webdesign 4092 price 8328 Cranendonck → Budel-Schoot 38
simonsehoveniers.nlSimonse HoveniersThe website of Simonse Hoveniers presents the services of a landscaping company, primarily focused on garden design, landscaping, garden maintenance, and the construction of pergolas and verandas, and offers service area around Emmeloord and surroundings.Landscaping → Garden Installation 617 garden maintenance 462 pergola 492 garden design 964 veranda 1055 groundwork 1348 landscaping 1529 Noordoostpolder → Emmeloord 1649
dzenpartners.nlDZ & Partners b.v.DZ & Partners b.v. is a recruitment agency specializing in personnel, organization, recruitment & selection, and temporary staffing, primarily serving the region around Emmeloord.HR Services → Technical Recruitment 474 personnel 1084 recruitment 2015 staff 3405 region 5412 Noordoostpolder → Emmeloord 1649
leerlingbezoekdagen.nlStudent Visitation DaysThe website describes the Student Visitation Days, an initiative of various MBO and VO institutions in the region of North Holland, which offer 4th-year vmbo students the opportunity to spend a day observing potential follow-up education programs and preventing early school dropout.Knowledge → Education 69666 region 5412 De Fryske Marren → Lemmer 1188
lowvoltageink.nlLow Voltage InkLow Voltage Ink is a tattoo and piercing studio that offers a variety of services, including tattoos, permanent makeup, scar camouflage, micro hair pigmentation, piercings, and tattoo removal.Art Forms → Tattoos 381 micro hair pigmentation 19 piercing 157 permanent makeup 702 tattoo 799 appointment 13510 De Fryske Marren → Joure 689
vandijksroggebrood.nlVan Dijk's RoggebroodVan Dijk's Roggebread is a bakery specializing in the production and sale of rye bread.Bread → Sourdough Bread 14 oven 324 bakery 718 recipe 5142 family 6462 De Fryske Marren →  Sintjohannesga 24
arnoldhoman.nlArnold HomanThe website of Arnold Homan showcases his architectural services and expertise, focusing on visualizing, connecting, and sustainable development of spatial projects for individuals, companies, and governments.Architecture & Design → Engineers 60 Architecture & Design → Architectural Consulting 490 visualization 621 idea 2367 architecture 3223 sustainability 18451 De Fryske Marren → Delfstrahuizen 47
chaletsinfriesland.nlAloys SpijkermanThe Chalets in Friesland website offers for rent luxurious chalets in Friesland, specifically in the Gaasterland region, emphasizing a relaxing holiday in a wooded area near the IJsselmeer.Camping → Campsites Netherlands 792 chalet 1264 forest 1418 campsite 2093 vacation 4234 De Fryske Marren → Rijs 32
thechristmassisters.nlThe Christmas SistersThe website of The Christmas Sisters presents a program of Christmas serenade and concert performances taking place in various locations in Drenthe, with a focus on creating a festive atmosphere during the Christmas period.Events & Venues → Christmas Music 23 Holidays → Christmas 937 tour 2315 concert 4409 video 6714 photo 7778 De Fryske Marren → Echten 54
kindertherapiedebron.nlKindertherapie de BronKindertherapie de Bron is a practice offering integrative child therapy, focused on helping children and their parents overcome problems and find a new balance.Child & Adolescent Development → Child Psychology 1077 Childcare → Individual Support 208 problem 2214 parent 4318 balance 4582 therapy 7448 child 11566 De Fryske Marren → Lemmer 1188
vandermolengrondwerken.nlVan der Molen GrondwerkenVan der Molen Grondwerken is a company specializing in ground breaking and crane rental services.Construction Machinery → Crane Rental 135 Land Development & Earthworks → Earthmoving 643 groundbreaking 32
jmdt.nlJ&M Sustainable TechnologyThe JMDT - Sustainable Technology website provides information and services related to the installation of solar panels and charging stations, as well as meter boxes, with a focus on sustainable energy solutions in the West Friesland, Schagen, and Alkmaar regions.Electric Vehicles → Charging Stations 303 Energy → Electricity 712 battery system 39 meter box 176 charging station 789 solar panels 4701 De Fryske Marren → Lemmer 1188
oshaarseweg24-104.nlZandbergen MakelaardijThe website of Zandbergen Makelaardij offers a house for sale on the Westerbergen Holiday Park in Echten, Drenthe.Accommodation → Holiday Parks 1024 Accommodation → Bungalows 1008 land 472 bungalow 687 park 1863 bedroom 2051 landscape 2609 house 8121 De Fryske Marren → Echten 54
notariaatlemmer.nlNotariaat LemmerNotariaat Lemmer is a notary public offering legal services, primarily in the areas of inheritance law, real estate transactions, and boating.Property Location & Neighborhood → Property 695 Legal → Notaries 848 business law 157 inheritance law 206 will 510 boat 2980 mortgage 4564 real estate 4981 De Fryske Marren → Lemmer 1188
dekoningstuc.nlStukadoorsbedrijf de Koning B.V.Stukadoorsbedrijf de Koning B.V. is a well-established family business specializing in exterior insulation, plastering, painting, and maintenance services for private and business clients.Facades & Cladding → Facade Systems 97 Insulation → Exterior Insulation 20 facade cleaning 385 plaster 2175 paint 8747 maintenance 20093 De Fryske Marren → Lemmer 1188
sahfryslan.nlStichting Apotheekhoudende Huisartsen FryslânThe Stichting Apotheekhoudende Huisartsen Fryslân represents the interests of pharmacy-based general practitioner practices in North Netherlands.Hospital & Acute Services → Hospitals 735 Medical Care & Services → Primary Care 5699 purchase 2212 care 12338 collaboration 16036 De Fryske Marren → Bakhuizen 45
anderplan.nlAnderplanThe website of Anderplan presents the profiles and projects of Duurt Snoeijers, a creative specialist in area development, who primarily performs project management and restructuring for municipalities.Planning & Development → Spatial Planning 889 Freelance & Independent → Self-Employed Professionals 159 restructuring 142 area development 219 project management 3423 municipality 6837 De Fryske Marren → Balk 224
dierenartspraktijkmarknesse.nlDierenartspraktijk MarknesseThe website of Dierenartspraktijk Marknesse provides information about the veterinary practice, its team, services, opening hours, and location in the Noordoostpolder.Landscape → Polders 212 Veterinarians → Veterinary Clinics 419 veterinary practice 71 companion animals 83 emergency 750 opening hours 2953 Steenwijkerland → Sint Jansklooster 61
sjipko.nlSjipkoThe website of Sjipko presents handcrafted cosmetics, primarily soap and shampoo bars, made from cow's milk and natural ingredients. The company emphasizes sustainability through the use of paper packaging and the origin of the milk from Friesland.Local Events → Markets 1097 Cosmetics & Skincare → Cosmetics 1122 shampoo bar 28 natural ingredients 84 soap 231 market 2772 package 6112 Southwest-Friesland → Makkum 229
angelcreations.nlAngel CreationsThe website of Angel Creations showcases green decor, primarily moss and plant paintings, as well as custom creations and workshops.Gardening → Soil Improvement 129 Living → Sustainable Living 817 moss 69 diy 443 workshop 19325 De Fryske Marren → Lemmer 1188
werkenbijschadenberg.nlSchadenberg GroupThis website of Schadenberg Group presents open job vacancies and provides information about the company culture, training opportunities, and different business units of the family-owned business.Jobs → Vacancies 1099 Staffing & Recruitment → Temporary Staffing 1003 business unit 129 company culture 149 vacancy 6598 training 28133 De Fryske Marren → Lemmer 1188
potmaaccountants.nlPotma AccountantsPotma Accountants is a full-service accounting firm that advises and supports businesses and individuals.Government & Legal → Tax 1322 Finance & Insurance → SMEs 433 business transfer 48 zzp 121 accounting firm 250 payroll administration 979 tax advice 1522 account 5781 De Fryske Marren → Joure 689
itnoard75.nlIt Noard 75 – Makelaardij HoekstraThe website of It Noard 75 – Makelaardij Hoekstra presents a traditional farmhouse dating back to 1915 located in Broek, Friesland, Netherlands, providing details about the property’s characteristics, location, and potential uses.Apartment Living → For Sale 1007 Accommodation → Holiday Homes 727 waterway 120 living space 244 farmhouse 878 plot 1051 De Fryske Marren → Broek 21
dierenartsobdam.nlDierenartsenpraktijk ObdamDierenartsenpraktijk Obdam provides professional animal care for farm animals, horses, and companion animals in Obdam, West Friesland.Animals → Animal Care 1849 Animals → Veterinarians 813 laboratory 478 veterinarian 864 animal 2908 horse 4337 practice 9089 care 12338 De Fryske Marren → Lemmer 1188
robdevlieger.nlRob de VliegerThis website is a platform providing information about horse racing, particularly short distances, recent race results, news, and an archive.Apparel → Equestrian 2319 race 1043 results 3954 horse 4337 video 6714 photo 7778 news 15293 Wassenaar → Duindigt 15
upgoing.nlUPGOINGThe UPGOING website provides consulting, training, coaching, and team-building solutions focused on personal development, change management, vitality, and increasing workplace enjoyment for individuals, companies, and organizations.Management → Leadership Training 790 entrepreneurship 1579 vitality 1726 leadership 3724 coach 25810 training 28133 De Fryske Marren → Lemmer 1188
itbertehus.nlVerloskundigenpraktijk it BertehûsThe website of Verloskundigenpraktijk it Bertehûs provides information about the practice, its services, and the areas it serves with obstetrical care.Pregnancy & Childbirth → Obstetrics 240 midwife 553 supplement 1968 pregnancy 2739 Leeuwarden → Reduzum 25
diamondsound.nlDiamond SoundThe website of Diamond Sound is an audiovisual company based in Friesland, offering a range of services including event production, corporate presentations, congresses, and the rental of audiovisual equipment.Event Planning → Sound 339 Technology → Audiovisual & Media 688 sound 1649 presentation 1785 image 2605 equipment 4143 light 5148 event 45199 De Fryske Marren → Joure 689
web-sitebouw.nlWEB-SitebouwThe website of WEB-Sitebouw offers custom website solutions for businesses, focusing on professional design, rapid development, reliable hosting, and search engine optimization.Web Hosting → Managed WordPress Hosting 89 hosting 3125 wordpress 3551 portfolio 6854 webshop 8648 design 27202 De Fryske Marren → Joure 689
dietistenpraktijktov.nlDiëtistenpraktijk ToV!Diëtistenpraktijk ToV! is a dietician practice located in West-Friesland and Flevoland that provides lifestyle counseling and specializes in areas such as pediatric dietetics and GLI.Nutrition → Dietetics 816 gli 53 diabetes 750 lifestyle 2918 nutrition 4935 therapy 7448 child 11566 De Fryske Marren → Lemmer 1188
meerpersoneelsdiensten.nlMeer PersoneelsdienstenMeer Personeelsdiensten is an employment agency that focuses on placing employees in a safe and trusted work environment, with personal guidance.Context 161394 workplace 1046 employee 4429 vacancy 6598 collaboration 16036 Smallingerland → Drachten 2052
bouwdeboer.nlBouwservice Jakob de BoerThe website of Bouwservice Jakob de Boer is an information source and contact point for extension, renovation, and remodeling projects, with a focus on Northern Netherlands.Construction Companies → Additions 458 Renovation → Bathroom Renovation 834 remodeling 335 extension 1941 bathroom 3784 kitchen 6443 renovation 13849 Heerenveen → Akkrum 246
tjoektjoek.nlTjoek TjoekThe website offers rental of Solexes and Tuk Tuks, allowing visitors to explore the region of West-Friesland in a unique and enjoyable way.Cars → Rental Cars 58 Travel → Tourism 3754 tuktuk 38 solex 61 adventure 919 tour 2315 rental 7257 De Fryske Marren → Lemmer 1188
veenstraklussen.nlKlus- en onderhoudsbedrijf VeenstraKlus- en onderhoudsbedrijf Veenstra is a construction company offering various building-related services.Roofing → Skylights 471 Construction Companies → Finishing Contractors 383 skylight 966 carpentry 2218 frames 2556 restoration 3417 renovation 13849 maintenance 20093 Westerkwartier → Oostwold 67
rodebieten.nlStam-Schaap Agro BVThe website of Stam-Schaap Agro presents the company as a specialist in the cultivation, trade, and processing of beetroots (kroten) and describes the working method, production process, and location of the establishment.Produce & Vegetables → Vegetables 1070 processing 334 cultivation 481 De Fryske Marren → Lemmer 1188
msxworldwide.nlMSX WorldwideThe website msxworldwide.nl is a platform for news, reports, and a shop related to the MSX computer club and magazine.Local Communities → Villages 1005 Hobbies & Recreation → Computer History 20 club day 20 photo gallery 206 future 404 fair 583 magazine 2182 De Fryske Marren → Lemmer 1188
zorgpleinlemmer.nlZorggroep AntoniusThe Zorgplein Lemmer provides a wide range of healthcare services and support for residents of Lemmer and surrounding areas.Social Services → District Teams 58 Medical Care & Services → Primary Care 5699 general practitioner 508 midwife 553 home care 827 physiotherapy 4688 De Fryske Marren → Lemmer 1188
itpertoer.nlIKC It PertoerThe website of IKC It Pertoer in Weidum provides information for interested parties about the school, its mission, vision, staff, facilities and contact details. The aim is to support the development of the children attending the school.Childcare → After-School Care 765 Childcare → Daycare Centers 987 mission 1000 teacher 2890 school 7856 community 7931 Friesland → Harlingen 978
logopediepraktijkbalk.nlLogopediepraktijk BalkThe website of Logopediepraktijk Balk provides information about the offered speech therapy services and an opportunity to schedule an appointment.Childcare → Language Development 574 Learning Disabilities → Dyslexia 438 reflex integration 85 dyslexia 408 speech therapy 540 language 2016 practice 9089 appointment 13510 De Fryske Marren → Balk 224
nwghoveniers.nlNWG HoveniersNWG Hoveniers is a landscaping company based in North Netherlands offering services for garden design, landscaping, boundary demarcation, paving, and pond construction.Garden Maintenance → Garden Landscaping 711 Energy & Sustainability → Green Services 263 gardener 299 pond 686 green 889 landscaping 1529 garden 13129 maintenance 20093 De Fryske Marren → Balk 224
kyeierdewurk.nlKye IerdewurkKye Ierdewurk is a pottery studio offering children's birthday parties and workshops.Ceramics → Pottery 292 Hobbies → Creative Hobbies 412 pottery 152 clay 495 workshop 19325 De Fryske Marren → Balk 224
happy-stay.nlHappy StayHappy Stay is a website that rents out holiday homes, including villas, apartments, and group accommodations, with a focus on a relaxing and enjoyable vacation.Accommodation → Rental Properties 214 AccommodationTypes → Holiday Rentals 20 destination 2580 holiday home 2753 app 4595 accommodation 4921 De Fryske Marren → Lemmer 1188
wowbenikdat.nlWow ben ik dat?The website of Wow ben ik dat? offers holistic health coaching and German Medicine, aiming to identify and treat the root causes of health complaints, psychological issues, and social problems.Alternative Medicine → Holistic 1153 Complaints → Chronic Complaints 16 complaint 6479 coach 25810 De Fryske Marren → Lemmer 1188
jongejansbouw.nlJongejans BouwThe website of Jongejans Bouw presents the services of a construction company with over 25 years of experience in West-Friesland, focusing on new construction, renovation, maintenance, and refurbishment, and offers a portfolio of projects.Renovation → Extensions 651 Outdoor Living → Verandas 497 skylight 966 veranda 1055 extension 1941 construction 7421 renovation 13849 De Fryske Marren → Lemmer 1188
oktoberfest-joure.nlOktoberfest JoureThe website provides information about the Oktoberfest Joure, a yearly event that will return to Joure in 2025 on the Merk.Festivals → Beer Festivals 175 Festivals → German 17 oktoberfest 74 ticket 2785 music 13170 event 45199 De Fryske Marren → Joure 689
dwbaannemers.nlDWB AannemersThe DWB Aannemers website presents the company as a trusted contractor in West-Friesland, specializing in new construction, renovation, and remodeling of homes and businesses.Business & Finance → Construction Cost Management 295 remodeling 335 contractor 1039 new construction 2672 renovation 13849 sustainability 18451 De Fryske Marren → Lemmer 1188
septictankbeton.nlSeptictankbeton.nlThe website of Septictankbeton.nl sells concrete septic tanks of various sizes and offers expert advice and delivery throughout the Netherlands.Installation & Fixings → Installation Materials 247 Environmental Services → Water Treatment 265 septic tank 27 capacity 282 concrete 973 De Fryske Marren → Joure 689
offertes-grafmonumenten.nlGravestones NetherlandsThis website provides an overview of companies that supply and install gravestones and monuments in the Netherlands and Belgium.Funerals → Grave Monuments 88 Trade → Stone Trade 32 gravestone 161 monument 1168 quote 12863 Zaanstad → Wormerveer 530
focusoporde.nlChrista de BosThe website offers decluttering and Feng Shui services aimed at creating order, peace, and positive energy in the home.Home → Decluttering 161 feng shui 63 decluttering 197 overview 329 home 7976 energy 9075 De Fryske Marren → Joure 689
copyshop-overzicht.nlCopyshop OverzichtThe website provides an overview of Copyshops (copy shops) in the Netherlands, including opening hours and prices.Directories → Websites 3473 Design & Creative → Graphic Services 1003 thesis 228 opening hours 2953 price 8328 Beekdaelen → Nuth 223
hospestechniek.nlHospes TechniekHospes Techniek is an installation company offering a variety of services, including sustainability solutions, water softening, solar panels, and pellet boilers.Installation & Repair → General Installation 727 Energy → Renewable Energy 1267 technology 6816 energy 9075 installation 13742 sustainability 18451 maintenance 20093 De Fryske Marren → Lemmer 1188
admiraal-elektrotechniek.nlAdmiraal ElektrotechniekAdmiraal Elektrotechniek is an electrical installation company that provides services to private and business clients.Electrical Engineering → Electrical Installation Companies 62 Lighting & Electrical → Utilities 388 electrical installation 264 work 3122 region 5412 training 28133 Hardenberg → Broeklanden 27
weidseblik.nlWeidse BlikThe website ‘Weidse Blik’ offers sales and advisory services related to feed for ruminants and related agricultural products and services.Livestock → Animal Husbandry 1106 Fruit & Orchard Management → Crop Production 123 grazing 57 grass 238 fertilizer 298 feed 672 De Fryske Marren → Joure 689
bergsmadrain.nlDrainagebedrijf Bergsma DrainBergsma Drain is a drainage specialist serving sectors like agriculture, water construction, and sports, with over 50 years of experience.Plumbing → Drainage 570 Agriculture → Agricultural Services & Contracting 708 machine park 642 soil 930 drainage 1322 De Fryske Marren → Terkaple 24
dickpool.nlPannendekkersbedrijf D. Pool B.V.Pannendekkersbedrijf D. Pool is a specialist in roofing, specializing in anchoring tiles in the regions of North Holland, Friesland, and Flevoland.Roofing → Roof Repair 647 roofing 2806 tile 2869 construction 7421 renovation 13849 De Fryske Marren → Lemmer 1188
installatietechniekhuberts.nlInstallatietechniek HubertsInstallatietechniek Huberts is an installation company providing services in the Lemmer area and surrounding regions, specializing in heat pumps, central heating systems, and electrical installations.Heating → CV Boilers 167 Heating → Underfloor Heating 343 central heating 190 electrical installation 264 underfloor heating 757 heat pump 2541 roofing 2806 installation 13742 Noordoostpolder → Emmeloord 1649
groenmaatbedrijfsgroen.nlGroen/maat bedrijfsgroenGroen/maat bedrijfsgroen is a learn-to-work company that helps people with a distance from the labor market and benefit recipients find jobs in the green sector.Economy → Employment & Labor 6059 job 2795 De Fryske Marren → Lemmer 1188
bosch-hit.nlBosch HIT BVThe website of Bosch HIT BV presents the company as an independent installation company specializing in solutions for dairy farms in North West Friesland and North Holland.Livestock → Dairy Farming 671 Manufacturing & Industrial → Industrial Services 400 milk robot 26 dairy farm 129 installation 13742 De Fryske Marren → Lemmer 1188
zorgbegeleidingzbl.nlSpecialistische OnderwijszorgSpecialistische Onderwijszorg provides ambulatory specialist educational support and individual guidance to young people and children struggling in education.Childcare → Individual Guidance 103 Home & Community Care → Social Care 146 pathway 447 goal 4974 network 11123 Meierijstad → Erp 304
heerenveen-verstopping.nlRiool Service SchaapRioolservice Heerenveen provides drain cleaning, blockage removal, and drain inspection services in and around Heerenveen.Plumbing → Drain Cleaning 745 drain cleaning 63 drain 886 blockage 965 inspection 4279 De Fryske Marren → Joure 689
grova.nlGrova Schilders en KlussenbedrijfGrova Schilders en Klussenbedrijf is a painting and handyman company based in Almere, offering services in Flevoland and surrounding areas.Home Improvement & Services → Home Maintenance 1002 side 74 wood rot 541 handyman 836 wallpaper 1756 paint 8747 furniture 8751 De Fryske Marren → Bantega 19
hm-yachtrental.nlHM YachtrentalThe HM Yachtrental website offers yacht rentals, specifically steel yachts ranging from 10 to 12 meters in length, with various sleeping arrangements and provides information about sailing routes and renting the yachts, including sailing courses and potential sailing holidays.Water Sports → Water Recreation 599 Marine & Watercraft → Ships 132 yacht 647 harbor 691 route 3425 rental 7257 course 14728 Land van Cuijk → Cuijk 832
mullermakelaardij.nlMuller MakelaardijMuller Makelaardij is a real estate agency specializing in the watersport industry, facilitating the sale and valuation of properties and businesses.Real Estate → Commercial Property 1840 marina 487 watersport 540 real estate 4981 De Fryske Marren → Echtenerbrug 24
watersporttechniekzondervan.nlWatersporttechniek ZondervanWatersporttechniek Zondervan is a watersport company specializing in electric installations and sailing.Manufacturing & Industrial → Industrial Services 400 Business → Industry 36977 relocation 364 water 2501 installation 13742 Heerenveen → Akkrum 246
salihsbarbershop.nlSalih’s BarbershopSalih’s Barbershop is a new barbershop in Lemmer that offers men’s haircuts, shaves, and hair styling.Men’s Grooming → Barbershops 1012 shave 179 barbershop 512 haircut 1158 craftsmanship 1858 styling 2331 De Fryske Marren → Lemmer 1188
rechtstreeksadvocatuur.nlRechtstreeks AdvocatuurRechtstreeks Advocatuur provides legal services to clients in the West Friesland region, with expertise in various legal areas.Law → Family Law 1413 procedure 750 legal 937 lawyer 2683 De Fryske Marren → Lemmer 1188
somar-webdesign.nlSomar Webdesign St. NicolaasgaThe website of Somar Webdesign offers professional website design and website management, primarily aimed at the SME sector, with the customer having full control over the website's content.Web Design → Content Management 293 Online Marketing → Website Marketing 69 brand style 276 functionality 417 cms 613 wordpress 3551 De Fryske Marren → Sint Nicolaasga 146
circulairestaalbouw.nlVic Obdam StaalbouwThe website of Vic Obdam Staalbouw describes their expertise in circular steel construction and their contribution to sustainable building projects, particularly for residential and commercial building projects.Building & Construction → Sustainable Building 1004 Building & Materials → Steel & Metal 779 circular 369 steel 1177 construction 7421 sustainability 18451 De Fryske Marren → Lemmer 1188
totalprotections.nlTotal ProtectorsThe Total Protections website offers self-defense and resilience training, primarily based on the Krav Maga system.Sports & Fitness → Sports Programs 367 Sports & Fitness → Sports Training 711 krav maga 86 self-defense 275 training program 576 resilience 1091 De Fryske Marren → Lemmer 1188
luxbyrobin.nlLúx by RobinLúx by Robin is a hair salon in Lemmer, run by Robin, focused on creating a pleasant and inspiring atmosphere to send customers home with fantastic hair.Cosmetics & Aesthetic → Personal Care 1001 vegan products 12 natural ingredients 84 hair salon 717 trend 1865 hair 3014 De Fryske Marren → Lemmer 1188
yeah-online.nlYeah OnlineThe website of Yeah Online is a web design agency based in North Holland that helps businesses with website design, development, SEO, logo design, and graphic design, and also offers hosting and support.Online Marketing → SEO 1123 graphic design 2042 hosting 3125 seo 3707 webdesign 4092 logo 4660 Drechterland → Schellinkhout 51
ingenieursburoprompt.nlIngenieursburo PromptIngenieursburo Prompt offers software solutions to optimize bakeries, from retail to production.Software → Productivity & Office 1203 Food & Beverage → Food Industry 835 cash system 69 bakery 718 office 2898 production 4582 software 8291 Meierijstad → Veghel 1288
paraderma.nlParaDerma De GoornParaDerma De Goorn is a practice offering dermatology and lymphedema therapy.Dermatology → Skin Therapy 661 lymph 12 lymphedema 24 dermatology 127 acne 399 treatment 21203 Purmerend → Middenbeemster 367
jaxschilderwerken.nlJAX SchilderwerkenThe website of JAX Schilderwerken presents the services of a painting company, primarily focused on interior painting, exterior painting, glazing, and wallpapering, and offers inspiration and information about the company’s workflow and values.Interior → Woodwork 86 Installation & Repair → Tradespeople 409 painting company 306 trend 1865 wishes 2717 paint 8747 De Fryske Marren → Lemmer 1188
agapanthusbb.nlAgapanthus Bed & BreakfastThe website of Agapanthus Bed & Breakfast presents a luxurious bed & breakfast in Hoogkarspel, North Holland, offering accommodation and a relaxing hotel stay near historical cities.Cycling → Cycling Routes 1002 Vacations → City Breaks 536 bed & breakfast 319 train 341 parking 1928 room 3411 terrace 4847 studio 5465 Drechterland → Oosterwijzend 177
hanotex.nlHanotex International BVThe website of Hanotex International BV presents the company as an innovative supplier of technical textiles (non-wovens) and custom solutions for various industries, with a focus on quality and sustainability.Commerce → Wholesale 1855 filtration 60 crop protection 65 custom solution 179 De Fryske Marren → Joure 689
glaszetter-nu.nlglaszetter-nu.nlThe website glaszetter-nu.nl is a platform that helps consumers find a local glazenzetter (glazier) in their region. It provides a directory of glazers in various provinces of the Netherlands.Windows → Glazier 440 glazier 174 province 518 region 5412 Westerkwartier → Zuidhorn 286
kap-zones.nlKap-zones by BarbaraKap-zones by Barbara is a hair salon in Joure offering hairstyling and makeup services.Weddings → Bridal Styling 154 Makeup → Makeup Artists 733 hairstyling 482 hair salon 717 hairstyle 812 makeup 1477 atmosphere 5591 De Fryske Marren → Joure 689
stukadoorsbedrijfdeboer.nlStukadoorsbedrijf J. de BoerStukadoorsbedrijf J. de Boer is a plastering company operating in North Holland and West Friesland, specializing in plasterwork.Building & Materials → Plastering & Rendering 468 Building & Materials → Drywall & Gypsum Boards 452 recognition 114 plasterwork 247 region 5412 quote 12863 De Fryske Marren → Lemmer 1188
jyfotografie.nlJYfotografieThe JYfotografie website offers professional wedding photography services, specializing in wedding reportages with a fresh and modern style, focused on capturing the entire wedding story. Loveshoots and wedding albums are also offered.Wedding → Bridal Photography 119 Journalistic Visuals → Photojournalism 85 reportage 327 moment 1034 album 1495 wedding 4258 photo 7778 blog 13392 Tubbergen → Vasse 65
efoilfriesland.nlSail-a-way Sneekermeer BVThe website Efoil Friesland offers efoil lessons and opportunities to efoil on the Sneekermeer, without requiring waves or wind. The company aims to provide an accessible and easy-to-learn surfing experience.Water Sports → Surfing 143 sneekermeer 14 efoil 21 electric motor 24 wetsuit 77 remote control 109 De Fryske Marren → Goingarijp 86
hettwiskerveld.nlCamping Het TwiskerveldThis website presents Camping Het Twiskerveld, a rural farm camping in West-Friesland, North Holland, offering facilities such as wifi, a house (Het Melkmeisje) and caravans, as well as a variety of activities and attractions in the surrounding area.Camping → Farm Camping 386 Nature → Natural Areas 257 cycling route 451 wifi 1372 caravan 1394 camp 2466 animal 2908 house 8121 De Fryske Marren → Lemmer 1188
schadeherstellemmer.nlSchadeherstel LemmerSchadeherstel Lemmer is an auto body repair shop specializing in the repair of car and glass damages.Repair → Garage 1779 Repair → Glass Repair 262 windshield repair 13 auto body repair 38 calibration 166 camper 1596 paint 8747 De Fryske Marren → Lemmer 1188
damesfit.nlDamesfitDamesfit is a women-focused sports club in West-friesland that offers a variety of fitness programs and support.Fitness → Group Fitness 290 Sports → Group Class 2051 circuit training 41 pilates 545 group classes 1306 fitness 2251 yoga 3704 De Fryske Marren → Lemmer 1188
compleetinstijl.nlCompleet in StijlThe website of Compleet in Stijl offers professional interior design services for holiday homes, from interior design to delivery and assembly, aiming to furnish holiday homes according to the wishes of the client.Europe → France 1041 interior design 1802 holiday home 2753 photography 9503 De Fryske Marren → Elahuizen 24
kinderopvangtoeslagaanvragen.nlMinistry of Social Affairs and Digitalization (SZW)This website provides information and an application procedure for childcare subsidy (kinderopvangtoeslag).International Travel → Visas 93 Early Years → Childcare 6029 condition 425 application 3377 municipality 6837 Amsterdam → Weesp 1005
assurantiekantoor.nlAssurantiekantoor.nlThis website provides an overview of insurance agencies and insurance offices in the Netherlands.Services → Travel Insurance 99 Insurance & Risk → Insurance Brokerage 244 add 20 overview 329 province 518 Heerenveen → Hoornsterzwaag 36
riaschildert.nlRia ZeldenrustThe website RiaSchildert.nl is a portfolio and online presentation of Ria Zeldenrust, an artist residing in Bakhuizen, specializing in painting sheep and other landscape themes. It provides insight into her artistic development and her approach to painting.Painting → Acrylic Painting 547 Painting → Digital Art 820 sheep 274 acrylic 506 drawing 1101 paint 8747 De Fryske Marren → Bakhuizen 45
hwpsintnyk.nlHobbywerkplaats Sint Nyk e.o.The website of the HOBBY WERKPLAATS Sint Nyk e.o. provides information about the HWP and CREATHEEK, including their activities, members, opening hours, and contact details.Volunteering → Volunteer Organizations 683 Holidays → Sinterklaas 495 repair cafe 28 member 10154 De Fryske Marren → Sint Nicolaasga 146
sijkevandermeer.nlAtelier FantasijkeAtelier Fantasijke in Joure offers painting lessons and workshops for all levels, from beginners to advanced, focusing on various painting techniques and creating your own artwork.Painting → Acrylic Painting 547 Painting → Painting Courses 144 oil paint 202 watercolor 369 student 7623 paint 8747 workshop 19325 De Fryske Marren → Balk 224
visserendegraef.nlVisser en de Graef CommunicatieVisser en de Graef Communicatie is a communication agency with a long history in photography, design, and strategic advice.Advertising → Outdoor Advertising 254 campaign 3428 strategy 9379 photography 9503 brand 17737 design 27202 De Fryske Marren → Joure 689
loodgieterjoure.nlLoodgieter JoureLoodgieter Joure provides 24/7 plumbing services in Joure, focusing on urgent repairs and transparent pricing.Maintenance & Repair → Plumbers 879 plumber 1210 price 8328 repair 14576 De Fryske Marren → Joure 689
adelaarelektrotechniek.nlAdelaar ElektrotechniekAdelaar Elektrotechniek is an electrical installation company providing professional electrical services in North Holland and beyond.Energy → Electricity 712 Installation & Mounting → Installers 1007 emergency 750 electrician 819 electrical 1414 light 5148 network 11123 installation 13742 Medemblik → Andijk 242
dijkmanmakelaardij.nlDijkman MakelaardijThe website of Dijkman Makelaardij presents a portfolio of real estate, including homes, commercial properties, and appraisals, with a focus on the Lemmer and surrounding area.Real Estate → Regional Agencies 215 commercial property 469 appraisal 1488 portfolio 6854 rental 7257 property 7406 De Fryske Marren → Lemmer 1188
veldman-vlees.nlSlagerij VeldmanSlagerij Veldman is a butcher shop located in Joure, Friesland, specializing in the sale of artisanal and honest meat, including sausages, beef, pork, and chicken, with a particular focus on the Kesburger hamburger.Supermarkets & Grocery → Butchers 747 sausage 256 spices 340 buffet 1747 meat 2055 snack 2916 De Fryske Marren → Joure 689
speurtraining.nlSpeurtraining FrieslandSpeurtraining Friesland offers practical scent training for dogs of all breeds and ages, focused on strengthening the bond between dog and owner.Dog Care → Dog Walking Service 356 Nature & Outdoors → Outdoor 4031 handler 30 scent 333 dog 5483 training 28133 Westerveld → Havelte 228
jeugdspoar.nlJachtspoarThe website provides an overview of activities and events organized by the Jachtspoar organization, with a focus on the annual Jeugdspoar events and camping trips.Family Activities → Outings 763 Children’s Activities → Camps 172 police 480 camp 2466 De Fryske Marren → Sint Nicolaasga 146
sexdate321.nlSexdate 321The website provides a platform for sex dating, featuring profiles of women with their personal information.Dating → Online Dating 661 sexdate 47 woman 1419 profile 1965 Het Hogeland → Rottum 38
smitvastgoed.nlSmit Advies & MakelaardijSmit Advies & Makelaardij is a real estate agency focusing on the sale, rental, and management of residential and commercial properties in West-Friesland.Property Valuation & Appraisal → Residential Appraisal 622 Context 161394 commercial property 469 wishes 2717 space 3846 property 7406 De Fryske Marren → Lemmer 1188
benbklassiek.nlB&B KlassiekB&B Klassiek is a Bed & Breakfast located in Twijzelerheide, Friesland, offering accommodation in a classic manor house and surrounded by various attractions.Outdoor → Biking 90 Nature → Cycling 472 b&b 1060 bike 1541 breakfast 1822 parking 1928 room 3411 house 8121 Het Hogeland → Lauwersoog 295
tdkk.nlTDKKTDKK is a microscopy shop and service company specializing in creative microscopy and providing LED lighting solutions.Physics → Optics 27 microscope 48 lead 1195 part 5044 shop 6483 workshop 19325 De Fryske Marren → Echten 54
dicknoteboom.nlDick 's JamDick 's Jam is a website selling homemade jams, made from unblemished fruit from their own garden and using local ingredients.Wholesale → Food Products 303 Preserves → Jams 18 jam 122 fruit 1166 ingredients 2346 garden 13129 Heerenveen → Oranjewoud 64
bijstra.nlMakelaardij BijstraThe website of Makelaardij Bijstra offers real estate services including the sale, purchase, valuation, and appraisal of properties and businesses in Southwest Friesland.Property Agents & Brokers → Regional Agents 352 Property Advice & Guidance → Real Estate Advice 135 appraisal 1488 purchase 2212 sale 5930 house 8121 De Fryske Marren → Harich 35
joureserolluikenendeurenspecialist.nlJourese Rolluiken en DeurenspecialistThe website of ‘Jourese Rolluiken and Doors Specialist’ is a company that repairs roller shutters and overhead doors 24 hours a day in the Joure region and surrounding areas.Windows → Roller Shutters 47 Repair → Window Repair 18 overhead door 107 roller shutters 138 repair 14576 brand 17737 De Fryske Marren → Joure 689
paiva.nlPaiva BVThe website of Paiva BV describes their activities in project development, focusing on the (re)development of locations into new areas with various purposes, such as housing, businesses, and sustainable energy.Real Estate → Project Development 633 industry 1780 housing 4378 sustainability 18451 De Fryske Marren → Lemmer 1188
stichtinghaanstrahogenesch.nlStichting Haanstra Hogen EschThe website of the Stichting Haanstra Hogen Esch is dedicated to the work of the artists Johan Haanstra and Ina Hogen Esch, who settled in the village of Warns in South West Friesland.Painting → Dutch Art 322 Governance → Cultural Organization 151 stichting 481 atelier 1417 work 3122 artist 5745 De Fryske Marren → Lemmer 1188
sijmschilderwerken.nlSijm SchilderwerkenSijm Schilderwerken is a painting company that serves both private and business customers, offering painting and wallpapering services, both interior and exterior.Design & Projects → Self-Employed Entrepreneurs 505 Personal & Household → Handyman Services 576 customer friendliness 80 wallpaper 1756 paint 8747 De Fryske Marren → Lemmer 1188
artcenterjoure.nlArt Center JoureArt Center Joure is a center that combines art, freedom, energy, inspiration, and personal development for all ages.Handmade Jewelry → Jewelry Workshop 20 atelier 1417 yoga 3704 art 3856 shop 6483 workshop 19325 coach 25810 De Fryske Marren → Joure 689
affrecruitment.nlAFF Recruitment & Executive SearchAFF Recruitment & Executive Search is a recruitment agency specializing in matching professionals with companies, particularly in the agrifood sector, and offers both standard recruitment and executive search services.HR Services → Executive Search 737 executive search 122 candidate 1896 recruitment 2015 vacancy 6598 De Fryske Marren → Joure 689
scheepsmotoren-gebroedersdejong.nlGebr. De Jong B.V.The website of Gebr. De Jong BV provides motor repair and maintenance services for various applications, including marine and industrial engines.Maritime → Shipbuilding 568 Engineering → Mechanical Engineering 737 generatorsets 15 marine 50 engine 758 industry 1780 part 5044 De Fryske Marren → Joure 689
taxikuiper.nlTaxi KuiperThe website of Taxi Kuiper is an online platform presenting the services of a taxi company based in Sneek, Friesland, focused on passenger transport for various purposes, including business travel, airport transfers, and contract transportation.Taxi & Ride Services → Taxi 1062 Specialized Transport → Business Transportation 231 business transportation 13 airport transportation 28 chauffeur 452 taxi 2090 transportation 2851 Southwest-Friesland → Sneek 1921
kattenpensiondezwartekat.nlKattenpension De Zwarte KatKattenpension De Zwarte Kat offers accommodation for cats in a peaceful location in Friesland.Accommodation → Pet Hotels 89 Animal Care → Cat Care 132 litter box 40 cat food 98 cat 1578 pension 1682 room 3411 De Fryske Marren → Joure 689
rijverenigingdehjouwer.nlHippische sport vereniging de HjouwerHippische sport vereniging de Hjouwer is a sports association dedicated to equestrian activities, offering membership and various activities.Equestrian → Riding Clubs 245 Outdoor → Horse Riding 941 pony 409 horse 4337 lesson 5154 association 8562 membership 10442 De Fryske Marren → Haskerhorne 14
romyvanderwieluitvaartzorg.nlRomy van der Wiel UitvaartzorgRomy van der Wiel Uitvaartzorg is a funeral service provider based in Friesland that offers a range of services, including crematories, cemeteries and sustainable funerals.Death → Funerals 552 funeral service 127 cemetery 395 funeral 2477 wishes 2717 family 6462 De Fryske Marren → Joure 689
tismofolie.nlTismo FolieTismo Folie is a specialist in window films offering various functionalities, including sun protection, security, and energy savings.Windows → Window Film 12 Design & Creative → Specialized Services 238 sun protection 69 window film 135 energy saving 599 film 3007 security 6655 De Fryske Marren → Lemmer 1188
aquastop.nlAquastop WitgoedServiceAquastop is a white goods specialist in West Friesland offering repair, parts, and new appliance sales and installation services.Household Appliances → Appliance Repair 224 white goods 63 dishwasher 324 refrigerator 475 washing machine 487 part 5044 repair 14576 De Fryske Marren → Lemmer 1188
jltautoenboten.nlJLT Boten en AutoJLT Boten en Auto is a company in Lemmer that sells and rents boats, rubberboats, cars, trailers, accessories, and outboard motors, as well as offering maintenance and repair services.Car Selling & Valuation → Cars 2698 Automotive → Sales 1205 rubberboat 26 outboard motor 63 trailer 1624 boat 2980 car 10865 De Fryske Marren → Lemmer 1188
bohemianbeach.nlBohemian BeachBohemian Beach is a new and popular beach location in West Friesland, located in Enkhuizen on the IJsselmeer, offering vacation, relaxation, conviviality, and a unique Bohemian atmosphere.Conferences & Meetings → Meeting Venues 729 Beach Life → Beach Locations 28 bed 1384 event 45199 De Fryske Marren → Lemmer 1188
frouwkjespersonaltouchtravel.nlFrouwkje's Personal Touch TravelFrouwkje's Personal Touch Travel is a travel advisor that creates customized trips for individual clients.TravelBrands → Travel Agencies 1840 Services → Personal Services 1062 advisor 1055 trip 2032 holiday 2295 travel 7210 De Fryske Marren → Wijckel 25
webdesignerleeuwarden.nlWebdesign LeeuwardenThe website of Webdesign Leeuwarden offers web design, web store, and website support services, primarily aimed at businesses in Leeuwarden and surrounding areas.E-Commerce → Webshop Development 950 webstore 134 wordpress 3551 De Fryske Marren → Lemmer 1188
hawaiibar.nlHawaii BarThis website offers services for organizing waterpipe parties and events, including fruit waterpipes, decorations, and entertainment.Bars → Cocktail Bars 236 Parties → Themed Parties 583 tobacco 41 water pipe 118 dancer 220 fruit 1166 decoration 4085 party 5928 Coevorden → Diphoorn 51
muziekflat.nlDe MuziekflatDe Muziekflat offers music lessons including piano, guitar, and music theory, and focuses on musical development.Music Education → Music Schools 367 Music → Instrument 2850 teaching method 30 recording studio 50 music theory 62 music teacher 63 piano 820 guitar 1091 De Fryske Marren → Lemmer 1188
sansfumee.nlBridge Club Sans FuméeThe website of Bridge Club Sans Fumée in Lemmer provides information about the club, its activities, schedule, results and contact details.Card Games → Bridge 186 Politics & Government → Elections 12 bridge 557 schedule 2624 competition 4759 membership 10442 De Fryske Marren → Lemmer 1188
fotos-by-hannie.nlFOTO'S BY HANNIEThe FOTO'S BY HANNIE website showcases a collection of self-created photographs, primarily focusing on nature, cities, animals, flowers, and various other subjects.Nature & Landscape → Nature Photography 482 city 1875 animal 2908 flowers 3248 exhibition 5332 photo 7778 nature 9094 De Fryske Marren → Joure 689
aerialpromos.nlAerial PromosAerial Promos is a video production company specializing in creating films and videos that combine visuals, audio, and text to bring emotions to life and capture the audience's attention.Graphic Design → Motion Graphics 224 Live Events → Videography 1039 visuals 207 film 3007 video 6714 portfolio 6854 De Fryske Marren → Lemmer 1188
fysiotherapie-skipsleat.nlFysiotherapie SkipsleatFysiotherapie Skipsleat provides physiotherapy treatments in the Skipsleat neighborhood of Joure, focusing on personalized attention and the use of various therapies.Respiratory Diseases → Asthma 27 Alternative Medicine → Ayurveda 281 treatment plan 380 breathing 976 yoga 3704 physiotherapy 4688 complaint 6479 treatment 21203 De Fryske Marren → Joure 689
h4omakelaardij.nlH4O MakelaardijThe website of H4O Makelaardij presents real estate listings for sale and rent, and offers valuation services in the Zuidwest and Midden-Friesland region.Real Estate & Investment → Intangible Assets 123 listings 525 valuation 2697 property 7406 De Fryske Marren → Lemmer 1188
mycroft.nlStichting MycroftStichting Mycroft is a foundation working in collaboration with various organizations to support poverty reduction and provide access to educational resources, particularly laptops.Social Issues → Poverty Reduction 152 Pedagogy & Methods → Digital Education 56 learning 920 laptop 1320 sustainability 18451 De Fryske Marren → Lemmer 1188
kostenwebdesigner.nlkostenwebdesigner.nlThe website presents a list of web designers active in various regions of the Netherlands. It offers an overview of locations and contact information.Office & Workspace → Business Directories 421 webdesigner 40 province 518 Zwartewaterland → Genemuiden 405
echocentrumannekeschmidt.nlEchocentrum Anneke SchmidtEchocentrum Anneke Schmidt is a center in Joure specializing in medical ultrasounds and pregnancy care.Prenatal Care → Ultrasound 187 Pregnancy & Childbirth → Midwifery 619 echo 34 midwife 553 ultrasound 769 baby 1895 pregnancy 2739 De Fryske Marren → Joure 689
schuimbetonisolatie.nlSchuimbetonisolatieThe website ‘Schuimbetonisolatie’ provides information and the possibility to order foam concrete online for various insulation projects, including crawl space insulation and floor insulation, and also offers services relating to floor heating and floor renovation.Insulation → Insulation Companies 124 foam concrete 34 floor heating 86 calculator 475 insulation 2448 quote 12863 renovation 13849 De Fryske Marren → Balk 224
haasebouw.nlHaase Bouw B.V.The website of Haase Bouw B.V. presents the services of a construction company specializing in new construction, commercial construction, renovation and maintenance, with a focus on flexibility, sustainability and Twentse pragmatism.Construction Companies → Residential Construction 1013 construction 7421 renovation 13849 sustainability 18451 De Fryske Marren → Balk 224
martijnkeukenkast.nlMartijn Keuken & KastMartijn Keuken en Kast is a company that offers kitchen and cabinet design and implementation services.Bedroom → Wardrobes 49 Storage → Cabinets 612 wine climate cabinet 11 cabinet 1730 showroom 4883 kitchen 6443 design 27202 De Fryske Marren → Delfstrahuizen 47
rijschoolhoorn.nlRijschool HoornThe website of Rijschool Hoorn provides information about driving lessons, theoretical preparation (TheorieDrive), and tips for passing the driving test in Hoorn and West-Friesland. The goal is to attract new students.Driving & Vehicle → Vehicle Training 553 pass rate 198 driver's license 1283 trial lesson 1433 driving lessons 2453 instructor 3126 De Fryske Marren → Lemmer 1188
cczf.nlCommerciële Club Zuid-FrieslandThe Commerciële Club Zuid-Friesland is a network for leading entrepreneurs and decision-makers in the region.Social Organization → Networking Organizations 475 Networking & Collaboration → Young Entrepreneurs 44 inspiration 4081 member 10154 network 11123 event 45199 De Fryske Marren → Balk 224
apmkbranding.nlAPMK BrandingThe website of APMK Branding is a embroidery studio that focuses on embroidering clothing and other textiles for businesses and individuals, with a focus on quality and personalized service.Crafts → Embroidery 624 Communication & Content → Business Communication 390 embroidery 614 item 1125 logo 4660 collection 7566 clothing 9443 design 27202 De Fryske Marren → Sint Nicolaasga 146
technisi.nlTechnisiTechnisi is a technical staffing agency based in Northern Netherlands, connecting technical professionals with clients.Online Services → Job Boards 1036 Employment & Labor → Employers 608 specialist 938 agency 944 career 2513 vacancy 6598 technology 6816 Smallingerland → Drachten 2052
boatworldxl.nlBoatWorldXLBoatWorldXL is a specialist retailer of boats, tenders, and outboard motors, offering a wide selection of new and used boats, as well as service and storage options. The website provides an overview of available boats, information on boat rental and storage, and the company's contact details.Boats → Sloops 129 Marine & Watercraft → Watercraft 44 outboard motor 63 tender 329 boat 2980 rental 7257 De Fryske Marren → Joure 689
gernellhoveniers.nlGernell HoveniersGernell Hoveniers is a landscaping company specializing in garden design, construction, and maintenance for both private and commercial gardens.Garden Maintenance → Garden Improvement 33 woodwork 387 plant 4509 portfolio 6854 garden 13129 maintenance 20093 design 27202 De Fryske Marren → Lemmer 1188
taxirichardsneek.nlTaxi Richard SneekThe website of Taxi Sneek Richard presents a taxi company offering services in the Sneek region and surrounding areas, including transportation to and from Schiphol and various special transportation options.Taxi & Ride Services → Taxi 1062 Services → Personal Services 1062 ride 1075 taxi 2090 transportation 2851 region 5412 Southwest-Friesland → Bolsward 566
fysiotherapie-visser.nlFysiotherapie VisserFysiotherapie Visser in Joure offers physiotherapy treatments with a focus on identifying the cause of complaints and providing personalized guidance.Spa → Wellness Centers 238 therapist 1890 facility 2616 physiotherapy 4688 complaint 6479 treatment 21203 De Fryske Marren → Joure 689
zeetsiis-joure.nlZee TsiisDelicatessenwinkel Zee Tsiis in Joure offers a variety of delicacies, beverages, and gifts, emphasizing regional products from Friesland.Gifts → Gift Sets 200 Dairy & Cheese → Specialty Food Stores 64 regional products 391 nuts 417 tapas 465 cheese 1205 meat 2055 gift 6442 De Fryske Marren → Joure 689
oriental-palace.nlOriental PalaceThe website of Oriental Palace in Sint Nicolaasga presents the Chinese-Thai restaurant, providing information about opening hours, takeaway menu, catering options, and a gallery of photos.Food Delivery → Indian Cuisine 543 takeaway 653 gallery 1983 catering 6456 restaurant 11215 menu 13856 De Fryske Marren → Sint Nicolaasga 146
captaintractors.nlNoordmachines B.V.The website of Captain Tractors presents and sells compact / mini tractors equipped with Stage 5 Mitsubishi diesel engines, focusing on sustainability, reliability, and an attractive design.Machinery & Repair → Machinery 1045 Machinery & Repair → Tractors 266 dealer 757 engine 758 tractor 789 model 3546 finance 5341 maintenance 20093 Neder-Betuwe → Dalwagenseweg 219
bakkerinstallatieadvies.nlDave Bakker InstallatieadviesThe website of Energy Advice by Dave Bakker in Grootebroek offers energy advice to individuals and businesses, focusing on energy savings and sustainable installations such as solar panels, heat pumps, and air conditioning.Energy & Sustainability → Energy Consulting 883 Energy → Energy Trading 15 energy advice 165 air conditioning 2178 insulation 2448 heat pump 2541 solar panels 4701 property 7406 De Fryske Marren → Lemmer 1188
3vf.nl3VF Consultancy3VF is a consultancy firm providing financial planning, control, software selection and implementation services to accountants and SMEs.Government & Administration → Oversight 82 Government & Legal → Tax 1322 merger 323 control 911 finance 5341 account 5781 software 8291 De Fryske Marren → Balk 224
koopook.nlbeheerder-wijsvinger.nlThe website Koop ooK Duurzaam! is a guide for sustainable living and provides an overview of sustainable products and services.Consumer & Lifestyle → Sustainable Shopping 32 page 427 sustainability 18451 Eemsdelta → Delfzijl 615
stalbreimer.nlStal BreimerStal Breimer is a horse riding stable and boarding facility located in Southwest Friesland, offering riding lessons and other activities for horse enthusiasts.Animal Husbandry → Horse Farms 174 Outdoor → Horse Riding 941 pony 409 rider 594 stable 768 horse 4337 lesson 5154 De Fryske Marren → Lemmer 1188
bnbhemeltjelief.nlB&B met heerlijk ontbijt | Zuidwest FrieslandB&B HemeltjeLief is a Bed & Breakfast located in Southwest Friesland, offering accommodations for guests wishing to explore the natural surroundings and the Frisian region.Accommodation → Breakfast 364 Accommodation → Beds 228 friesland 692 b&b 1060 breakfast 1822 apartment 5088 nature 9094 Southwest-Friesland → Workum 363
friesland-buitenspeelgoed.nlFriesland BuitenspeelgoedThe Friesland Buitenspeelgoed website is an online store selling various outdoor play equipment, including trampolines, scooters, play structures, and accessories, aimed at families and children.Games & Puzzles → Toy Stores 347 play structure 48 trampoline 169 scooter 1236 showroom 4883 accessories 12975 Smallingerland → Drachten 2052
opdehoekmakelaardij.nlOp de Hoek MakelaardijOp de Hoek Makelaardij is a real estate agency that offers properties for sale and rent in Southwest Friesland.Real Estate → Commercial Property 1840 business property 74 listings 525 view 1045 appraisal 1488 valuation 2697 property 7406 Southwest-Friesland → Koudum 134
visagiemetpassie.nlSalon PassieSalon Passie is a beauty salon located in Balk and Zwolle, offering services such as skin improvement, nail styling, makeup, and eyelash extensions.Cosmetics & Aesthetic → Appearance 353 skin improvement 1058 trend 1865 skincare 1972 results 3954 treatment 21203 training 28133 De Fryske Marren → Balk 224
krachtvanopenbaaronderwijs.nlStichting AllureThe website ‘Kracht van Openbaar Onderwijs’ presents an initiative from the public elementary schools in West-Friesland, aimed at providing an overview and a way to connect with the schools.Childcare → After-School Care 765 Primary Education → Public Education 424 elementary school 82 school 7856 De Fryske Marren → Lemmer 1188
skorgenes.nlJachtbemiddeling Terherne-NauticThe website showcases Skorgenes, a Norwegian brand of yachts, and the activities of Jachtbemiddeling Terherne-Nautic as importer and dealer.Trade → Import 854 Marine & Watercraft → Yachts 189 importer 111 yacht 647 tradition 736 broker 902 model 3546 brand 17737 De Fryske Marren → Terherne 98
salonanneke.nlSalon AnnekeSalon Anneke is a hair and beauty salon located in Sintjohannesga, offering haircuts, wimper extensions, lash lifts, and other beauty treatments, focusing on relaxation and a personalized approach.Men’s Grooming → Barbershops 1012 beauty treatment 154 hairstyle 812 salon 5541 De Fryske Marren →  Sintjohannesga 24
lekgoed.nlLekgoed BVThe website showcases real estate projects and services, with a focus on new construction and the renovation of existing properties.Commercial Property → Commercial Space 489 Commercial Property → Industrial Space 18 unit 405 real estate 4981 Krimpenerwaard → Bergambacht 303
podozorg-joure.nlPodozorg JourePodozorg Joure is a practice in Joure offering podological care, including custom orthotics and treatment of foot complaints.Orthopedics → Foot Problems 977 Repair → Shoe Repair 179 foot complaints 34 podologist 63 shoe repair 110 orthotics 172 De Fryske Marren → Joure 689
kei-tof-stenen.nlKei TofKei Tof is a platform where users can register stones, map their location, and share them with others. The site also provides information on painting stones and a shop with related products.Jewelry → Gemstones 451 Textile Arts → Crafts 9117 stone 724 template 742 map 801 Haarlemmermeer → Nieuw-Vennep 869
corpotfotografie.nlCor Pot FotografieThe website of Cor Pot Photography showcases the work of a freelance photographer specializing in various types of photography, including corporate reports, travel photography, wedding photography, and event photography.Visual Communication → Visual Marketing 146 Arts → Imaging & Photography 7687 corporate report 18 reportage 327 wedding 4258 portfolio 6854 photography 9503 event 45199 De Fryske Marren → Lemmer 1188
dehrman.nlDeHRmanDé HRman is an HR consultant and recruitment agency specializing in the SME sector in West-Friesland.Online Services → Job Boards 1036 vacature 11 termination 82 jobseeker 300 interim 732 De Fryske Marren → Lemmer 1188
huisentuindecoshop.nlT.G. de Vries SiersmederijThe website of T.G. de Vries Siersmederij presents a metalworking and welding company that produces items for both home and garden, with a focus on craftsmanship and custom orders.Heating → Wood Stoves 136 Garden → Fences 824 chimney cap 29 garden furniture 578 decoration 4085 De Fryske Marren → Balk 224
yvonnekerkhof.nlYvonne Kerkhof + PartnersYvonne Kerkhof + Partners provides personal and professional development services to individuals and businesses, focusing on career coaching and professional identity development.Career → Career Development 1070 identity 1028 career 2513 coach 25810 training 28133 De Fryske Marren → Joure 689
salonsaskiaforbeauty.nlSalon Saskia for BeautyThe website of Salon Saskia for Beauty in Lemmer offers a wide range of beauty products and services, including permanent makeup, facials, waxing, threading, coloring, and pedicures, provided by experienced beautician Saskia de Jong.Makeup → Makeup Artists 733 Cosmetics & Aesthetic → Personal Care 1001 pmu 171 facials 302 permanent makeup 702 wax 711 De Fryske Marren → Lemmer 1188
werkenbijdk.nlDK Accountants & AdviseursThe website, Werkenbij DK, is a job board that recruits professionals to DK Accountants & Adviseurs and presents the opportunities for professional development within the company.Business Support & Advisory → Advisory 413 Finance & Accounting → Accounting 3092 challenge 1697 growth 4054 vacancy 6598 Medemblik → Zwaagdijk-Oost 124
dejongjoure.nlBV. S. de Jong & Zn.The website of BV. S. de Jong & Zn. provides information about the company, its history and current activities, particularly the sale of propane gas.Manufacturing & Industrial → Industrial Services 400 Agriculture → Agricultural Machinery & Equipment 631 technical service 72 De Fryske Marren → Joure 689
begeleid-werken.nlEsd©g©-ReigersdaalBegeleid Werken is an organization that assists individuals facing barriers to employment in finding suitable work.Legal Law → Labor Law 12 Economy → Employment & Labor 6059 workplace 1046 society 1376 work 3122 region 5412 story 8285 De Fryske Marren → Lemmer 1188
pietyschurer.nlBakker OntwerpThe website of Piety Schurer showcases the work and style of the visual artist Piety Schurer, who lives and works in Oudemirdum.Painting → Contemporary Art 805 Painting → Digital Art 820 realism 19 visual language 54 drawing 1101 paint 8747 De Fryske Marren → Oudemirdum 73
dvlmilieu.nlDVL Milieuservice BVThe website of DVL Milieuservice presents sustainable solutions for waste management, including containers, software, maintenance, and advice.Logistics → Waste Transport 32 Environment → Waste Management 2680 waste stream 110 container 1709 registration 4366 software 8291 collaboration 16036 De Fryske Marren → Sint Nicolaasga 146
jtbgroepenkasttechnyk.nlJTB Groepenkast TechnykThe website of JTB Groepenkast Technyk provides advice and customized solutions for the installation and maintenance of electrical panels and eco-systems in homes, performed by an experienced electrical specialist.Energy → Electricity 712 electrical panel 153 solar panels 4701 De Fryske Marren → Sint Nicolaasga 146
awerk.nlAwerk uitzendbureauAwerk uitzendbureau is a recruitment agency that connects job seekers and employers in Northern Netherlands.Recruitment → Personnel Services 162 Staffing & Recruitment → Temporary Staffing 1003 temporary staffing 79 employer 2383 job 2795 match 3471 vacancy 6598 De Fryske Marren → Joure 689
stalfandekadyk.nlStal fan de KadykStal fan de Kadyk is a horse farm in Sintjohannesga offering a variety of services for horses and owners.Dogs → Breeding 667 Apparel → Equestrian 2319 mare 166 stable 768 inspection 4279 horse 4337 training 28133 De Fryske Marren →  Sintjohannesga 24
triviavolleybal.nlTrivia VolleybalverenigingThe website of Trivia Volleybalvereniging provides information about the volleyball association, including news, photos, teams, and opportunities to become a member or sponsor.Team Sports → Volleyball 842 volleyball 617 sponsorship 2686 match 3471 membership 10442 news 15293 De Fryske Marren → Balk 224
kluspunt-lemsterland.nlKluspunt LemsterlandKluspunt Lemsterland is a versatile handyman service that offers a range of renovation and restoration services.Maintenance & Repair → Skilled Trades 220 handyman service 127 building 3204 restoration 3417 paint 8747 furniture 8751 De Fryske Marren → Lemmer 1188
alkemaadviseurs.nlAlkema AdviseursAlkema Adviseurs provides expert and independent tax advice to individuals and entrepreneurs.Personal Finance → Financial Planning 1017 bookkeeping 1319 planning 1969 administration 6587 De Fryske Marren → Sint Nicolaasga 146
stefspanhaak.nlStef Spanhaak TrappenspecialistThe website of Stef Spanhaak Trappenspecialist from Joure showcases custom-made stairs, ranging from modern to classic designs, and informs visitors about the work, experience, and contact options of the stairmaker.Construction & Renovation → Staircases 329 Construction & Renovation → Stairs 110 stair 815 wood 4153 design 27202 De Fryske Marren → Joure 689
gordeco.nlGordeco GordijnatelierThe website of Gordeco Gordijnenatelier provides information about the company, its target audiences, and the products it offers, with a focus on custom-made curtains and exclusive fabrics.Interior → Curtains 831 Home → Decor & Furnishings 5819 custom-made 176 cushion 823 curtains 1015 De Fryske Marren → Joure 689
mkmetaal.nlMK MetaalMK Metaal is a company that provides steel constructions, machine building, welding and repair services.Building & Materials → Steel & Metal 779 steel construction 142 machine building 279 welding 1051 structure 1305 quote 12863 repair 14576 De Fryske Marren → Lemmer 1188
gebrvanslooten.nlVan Slooten SchoonmaakbedrijfVan Slooten Schoonmaakbedrijf is a cleaning company that offers various cleaning and pest control services to individuals and organizations.Control → Pest Control 824 pest 354 equipment 4143 cleaning 4567 region 5412 Noordoostpolder → Emmeloord 1649
borstvoedingsadviezen.nlBoezemvriendjesBoezemvriendjes is a website that offers products and support for breastfeeding, with a focus on solving problems and facilitating milk production.Pediatric & Child Health → Breastfeeding 212 Children → Baby 1069 breast pump 56 breastfeeding 398 De Fryske Marren → Lemmer 1188
podototaal.nlPodototaal PodologiePodototaal is a podology practice that treats foot and posture complaints and makes insoles.Shoes → Orthopedic Shoes 71 Podology → Orthopedics 1525 insole 351 foot 1929 shoes 2699 patient 4082 complaint 6479 treatment 21203 De Fryske Marren → Bakhuizen 45
josekrijnen.nlSEA FoundationThis website presents the work of visual artist José Krijnen, focusing on her artistic residency at the SEA Foundation in Tilburg and her participation in the Tsjerkepaad 2025 event.Artistic Expression → Fine Art Photography 502 Painting → Contemporary Art 805 gesture 31 texture 76 residence 251 memory 1641 pattern 2012 paint 8747 De Fryske Marren → Haskerhorne 14
jolandabronsgeest.nlMassagepraktijk Jolanda BronsgeestThe website of Massagepraktijk Jolanda Bronsgeest presents a practice offering a variety of therapies, including shiatsu, sports massage, foot reflexology and connective tissue massage, aimed at treating complaints and providing relaxation.Alternative Medicine → Shiatsu 830 shiatsu 578 rate 2606 complaint 6479 therapy 7448 massage 7646 treatment 21203 De Fryske Marren → Haskerhorne 14
resultsgym.nlResults GymResults Gym is a sports club located in Lemmer and surrounding areas, offering fitness, group classes, and personal training.Personal & Household → Fitness Services 162 egym 91 personal training 1271 group classes 1306 fitness 2251 membership 10442 De Fryske Marren → Lemmer 1188
waterland-slotenservice.nlWaterland SlotenserviceWaterland Slotenservice is a 24/7 locksmith offering services in the Waterland region, including key repairs, lock installation and opening, and security advice.Security Systems → Lock Systems 124 keys 370 locks 953 door 2210 region 5412 price 8328 Edam-Volendam → Edam 379
chinatown-joure.nlChinatown JoureThe Chinatown Joure website provides an online ordering system for Chinese food and drinks, with the option to pick up orders on-site. The goal is to offer customers an easy way to order Chinese meals and enjoy them.Asian → Chinese 415 spring rolls 141 points 612 buffet 1747 dish 5936 order 6912 menu 13856 De Fryske Marren → Joure 689
hennyveenstra.nlHenny Op PadThe website ‘Henny Op Pad’ presents travel stories and descriptions of cycling and hiking tours, with a focus on the Border & Coast tour and the Appalachian Trail.Hiking → Routes 279 Cycling → Cycling Routes 1002 day 189 weather 817 hiking 841 tent 1328 bike 1541 route 3425 Het Hogeland → Uithuizen 187
skinlabbyiris.nlSkinlab By IrisSkinlab By Iris is a skin clinic that offers personalized skin improvement treatments and products.Cosmetics & Aesthetic → Dermatology 1980 Cosmetics & Aesthetic → Personal Care 1001 pigmentation 98 treatment plan 380 acne 399 skin improvement 1058 webshop 8648 treatment 21203 De Fryske Marren → Lemmer 1188
oktoberfestbalk.nlOktoberfest BalkThe website of Oktoberfest Balk provides information and ticket sales for the event taking place on October 11, 2025, in Balk. The aim is to inform visitors about tickets, clothing tips, and other relevant details.Nightlife → Clubs 358 Festivals → German 17 saturday 39 oktoberfest 74 ticket 2785 space 3846 event 45199 De Fryske Marren → Balk 224
suzanneoudfotografie.nlSuzanne Oud PhotographyThe website of Suzanne Oud Photography is an online portfolio and booking platform for a photographer specializing in various types of photography, including newborn, pregnancy, children’s, wedding, and cake smash photography. The website provides information about the services, prices, and location of the photography studio.Imaging & Photography → Family & Newborn 1285 cakesmash 51 newborn 293 photoshoot 1018 pregnancy 2739 wedding 4258 photography 9503 Opmeer → Hoogwoud 149
elbag.nlELBAG UitzendbureauELBAG Uitzendbureau Leeuwarden offers job vacancies in Friesland and surrounding areas.HR Services → Technical Recruitment 474 Staffing & Recruitment → Temporary Staffing 1003 temporary 57 agency 944 sector 1332 employee 4429 vacancy 6598 Waadhoeke → St. Jacobiparochie 47
massagepraktijklemmer.nlMassagepraktijk LemmerThe website of Massagepraktijk Lemmer introduces the services of massage therapist Agnes Harryvan and provides information about her treatments, prices, and contact details.Physical Therapy → Osteopathy 922 rate 2606 massage 7646 price 8328 practice 9089 course 14728 De Fryske Marren → Lemmer 1188
miesbartholomeus.nlMies Bartholomeus Applied Kinesiology PracticeThe website of Mies Bartholomeus Applied Kinesiology Practice presents information about her practice, her working methods and offered courses, focusing on applied kinesiology and treating various complaints in children.Pediatric & Child Health → Behavioral Issues 61 Emergency & Safety → Alternative Healthcare 567 kinesiology 85 complaint 6479 child 11566 course 14728 De Fryske Marren → Sint Nicolaasga 146
dafjeweg.nlKomgenietenThe website offers rental opportunities for historic Daf cars and provides arrangements for groups and individuals, focused on experiencing Dutch culture and landscapes.Outdoor & Recreation → Group Activities 509 Travel → Activities 885 daf 51 buffet 1747 arrangement 3104 route 3425 Steenwijkerland → Kuinre 55
kraamzorgstellingwerven.nlKraamzorg StellingwervenKraamzorg Stellingwerven is a collaboration of experienced postpartum care providers offering care in Weststellingwerf and surrounding areas.Family → Motherhood 255 Pregnancy & Childbirth → Postpartum Care 658 postpartum care provider 18 family life 32 postpartum care 236 breastfeeding 398 childbirth 894 parent 4318 Ooststellingwerf → Appelscha 331
altenburgfunderingstechniek.nlAltenburg FunderingstechniekThe website of Altenburg Funderingstechniek presents a complete solution for foundation work, with a focus on the use of mortelscrew piles and sustainable practices.Construction Technology → Foundation Technology 135 Building & Construction → Sustainable Building 1004 production process 168 foundation 6678 sustainability 18451 Southwest-Friesland → Arum 37
anderzwonen.nlAnderz WonenAnderz Wonen is a real estate agency specializing in rural housing and farms in Friesland, assisting clients with sales, purchases, and appraisals.Real Estate → Commercial Property 1840 Real Estate → Agricultural Real Estate 135 housing market 311 friesland 692 farm 2622 house 8121 De Fryske Marren → Balk 224
chaletdehuismus.nlChalet de HuismusThe website of Chalet de Huismus presents a chalet for rent in Gaasterland, offering information about the facilities, surroundings, and availability.Accommodation → Rental Homes 11 availability 256 surroundings 463 chalet 1264 campsite 2093 heat 2188 beach 3210 De Fryske Marren → Rijs 32
logerenbijsaar.nlLogeren bij SaarThe website is an online resource for information and bookings for Klein Bosland, a waldhaus (forest house) and B&B located in Friesland, near Drenthe and Groningen.Nature → National Parks 898 walking paths 35 b&b 1060 landscape 2609 kitchen 6443 Drechterland → Wijdenes 46
gebroedersfeenstra.nlGebroeders FeenstraThe website of Gebroeders Feenstra showcases their installation and carpentry services, catering to both small tasks and complete projects for homes.Building & Materials → Carpentry & Joinery 830 Household & Cleaning → Home Services 1321 task 1507 carpentry 2218 quote 12863 installation 13742 De Fryske Marren → Sint Nicolaasga 146
gdsolar.nlGD SolarThe website of GD Solar provides information about solar panels and PV systems, focusing on supply, installation, and advice.Audio → Components 489 Environment → Energy Solutions 255 pv system 11 inverter 313 solar panels 4701 Steenwijkerland → Belt-Schutsloot 29
bouwbedrijfhoogland-zn.nlBouwbedrijf Hoogland & ZnBouwbedrijf Hoogland & Zn is a construction company specializing in small-scale home maintenance and the installation of windows and Velux skylights.Windows & Doors → Windows 2999 Customer Service → Quotes 209 address 901 skylight 966 window 2030 portfolio 6854 repair 14576 maintenance 20093 De Fryske Marren → Joure 689
flisijn.nlStucadoorsbedrijf FlisijnStucadoorsbedrijf Flisijn provides plastering services for residential and commercial projects in Friesland and North Netherlands.Drywall & Gypsum Boards → Ceiling Materials 56 Construction Companies → Plasterers 843 ceiling 627 wall 1378 plaster 2175 quote 12863 Heerenveen → Akkrum 246
kinderpsychologen-nhn.nlKinderpsychologen Noord-Holland NoordKinderpsychologen Noord-Holland Noord is a practice providing psychological support to children and adolescents up to 18 years old and their parents/caregivers.Psychotherapy → Adolescent Psychotherapy 34 Mental & Emotional Well-Being → Youth Therapy 532 adolescent 91 psychologist 1196 problem 2214 practice 9089 child 11566 De Fryske Marren → Lemmer 1188
a6stukadoorsbedrijf.nlA6 StukadoorsbedrijfA6 Stukadoorsbedrijf is a plasterer located in Lemmer that offers a wide range of services.Construction Companies → Plasterers 843 plasterer 259 plaster 2175 De Fryske Marren → Lemmer 1188
ediestukadoors.nlEdie StukadoorsbedrijfEdie Stukadoorsbedrijf is a plasterer providing services in Lemmer and the province of Friesland, specializing in plastering ceilings, walls, and facades.Construction Companies → Plasterers 843 decorative plaster 120 concrete look 126 plasterer 259 plaster 2175 De Fryske Marren → Lemmer 1188
ramoklussenbedrijf.nlRamo KlussenbedrijfRamo Klussenbedrijf provides painting and plastering services in Lemmer.Building & Materials → Drywall & Gypsum Boards 452 plaster 2175 paint 8747 De Fryske Marren → Lemmer 1188
stukadoorsbedrijfkoperdraat.nlKoperdraatThe Koperdraat plastering company is a plastering contractor based in Oosterblokker, offering various plastering services in West-Friesland and the surrounding area.Construction Companies → Plasterers 843 wall 1378 plaster 2175 quote 12863 De Fryske Marren → Lemmer 1188
huisartsenpraktijkdebraamhof.nlHuisartsenpraktijk De BraamhofThe website of Huisartsenpraktijk De Braamhof provides information about the practice, staff, offered care, and options for patients. Its purpose is to inform patients and make the practice accessible.Digital & Telehealth → Patient Portals 329 medical assistant 19 practice nurse 27 doctor 1397 patient 4082 care 12338 appointment 13510 Brummen → Empe 51
bmhmotoren.nlBMH MotorenBMH Motoren is a specialist in the sale and trade-in of Triumph motorcycles, particularly twin-cylinder models.Classic Cars → British Cars 41 Cars → Brand 579 triumph 18 motorcycle 2110 part 5044 De Fryske Marren → Joure 689
theetuinhetkeiroosje.nlHet theehuis 't KeiRoosjeTheehuis & Evenementenlocatie 't KeiRoosje is an event location and tea room in West Friesland that focuses on organizing activities, parties, and providing tea and regional products.Tea & Coffee → Tea Rooms 229 Parks & Gardens → Garden 501 tea room 58 tea 1146 space 3846 party 5928 De Fryske Marren → Lemmer 1188
meeslandinstallatietechniek.nlMeesland InstallatietechniekMeesland Installatietechniek is an installation company offering a wide range of installation technical services, from minor repairs to complete renovations and new construction projects.Heating → Central Heating Installation 294 Installation & Repair → General Installation 727 cv-boiler 32 zinc 367 technician 815 installation 13742 renovation 13849 De Fryske Marren → Lemmer 1188
vrebo.nlVrebo InstallatietechniekVrebo Installatietechniek is an installation company based in Bakhuizen with over 30 years of experience in the private sector, offices, and retail spaces.Real Estate → Real Estate Technology 40 installer 677 rate 2606 new construction 2672 installation 13742 renovation 13849 De Fryske Marren → Bakhuizen 45
tijdelijkekeukenverhuur.nlTijdelijke Keuken VerhuurThe website TijdelijkeKeukenVerhuur.nl offers temporary mobile kitchens for rent, specifically targeting events, renovations, and situations where a permanent kitchen is unavailable.Kitchen → Kitchen Appliances 724 Property Rentals → Rental 1169 countertop 179 boiler 1240 kitchen 6443 rental 7257 De Fryske Marren → Lemmer 1188
begrafenisverenigingbakhuizen.nlBegrafenisvereniging BakhuizenThis website provides information about the Catholic Funeral Association of Bakhuizen, its services, membership, and history.Death → Funerals 552 Culture → Religion 8327 funeral association 63 parish 353 death 356 cemetery 395 urn 411 membership 10442 De Fryske Marren → Bakhuizen 45
benbdehegewei.nlBenBdeHegeweiB&B de Hegewei is a bed and breakfast offering guests a peaceful and comfortable stay.Accommodation → Guesthouses 726 Nature → National Parks 898 lake 352 village 808 b&b 1060 forest 1418 breakfast 1822 accommodation 4921 De Fryske Marren → Harich 35
jongtsjukemar.nlJong TsjûkemarJong Tsjûkemar is a project that organizes activity weeks for primary school students around the Tsjûkemar.Water → Lakes 232 Environmental Studies → Nature Education 159 learning 920 environment 4873 school 7856 nature 9094 De Fryske Marren → Delfstrahuizen 47
kraamfaam.nlKraamfaamThe Kraamfaam website provides information and registration for childcare services, offered by Gea and Sandra, who focus on personal support for pregnant women and their families.Pregnancy & Childbirth → Postpartum Care 658 intake consultation 19 pregnant woman 59 introduction 277 childcare 3512 family 6462
hartenvreugd.nlHartenvreugd Natuurhuisje & practice LymfeTouchHartenvreugd Natuurhuisje & practice LymfeTouch offers a personal retreat and provides holistic wellness services, including LymfeTouch therapies and podiatric care.Vacations → Nature Houses 34 Anatomy & Systems → Specific Conditions 205 lymph drainage 29 podiatry 114 pedicure 2196 De Fryske Marren → Balk 224
ansichtkaartenhuis.nlAnsichtkaartenhuis BVThe Ansichtkaartenhuis website offers a unique collection of postcards and sets, targeting collectors and enthusiasts.Collections & Antiques → Collections 177 Events → Postcards 56 collector 157 postcard 278 Het Hogeland → Leens 104
meergevel.nlMeergevelThe website of Meergevel offers facade renovation, facade cleaning, and restoration services with over 25 years of experience.Maintenance & Services → Facade Maintenance 673 Masonry & Plastering → Masonry 576 chimney renovation 13 jointing 17 facade restoration 18 facade renovation 130 facade cleaning 385 De Fryske Marren → Joure 689
dezorgformule.nlThe ZorgformuleThe Zorgformule provides guidance and treatment for social, psychological, and psychiatric problems for young people, adolescents, and adults.Social Services → Youth Care 566 youth 3126 goal 4974 collaboration 16036 treatment 21203 De Fryske Marren → Lemmer 1188
seniorenbond.nlSeniorenbond PancratiusSeniorenbond Pancratius is a social and sporty association for seniors and older adults in Oosterblokker.Social Organization → Senior Organizations 750 Recreation → Senior Activities 244 soos 40 outing 982 museum 2002 association 8562 Hoorn → Blokker 130
recreatiepark-westfriesland.nlRecreatiepark West-FrieslandThe website of Recreatiepark West-Friesland serves as an information center for the park’s owners, with updates on the board, activities, and news.Accommodation → Bungalow Parks 931 Nature → Nature Reserves 1032 bungalow 687 plot 1051 swimming pool 1664 park 1863 board 3438 De Fryske Marren → Lemmer 1188
aannemersbedrijfroblaan.nlAannemersbedrijf Rob LaanAannemersbedrijf Rob Laan provides new construction, renovation, and remodeling services to individuals and businesses.Business & Finance → Construction Cost Management 295 wishes 2717 building 3204 construction 7421 house 8121 renovation 13849 De Fryske Marren → Lemmer 1188
spinnrz.nlSpinnrZThe SpinnrZ Enkhuizen website offers indoor cycling classes for all levels, aiming to help individuals achieve their fitness goals through enjoyable and accessible workouts.Cycling → Indoor Cycling 11 canteen 210 trial lesson 1433 cycle 1906 training 28133 De Fryske Marren → Lemmer 1188
hulzingawatersportwolvega.nlHulzinga WatersportThe website of Hulzinga Watersport Wolvega offers services and products for water sports enthusiasts in the Friesland region, including boat maintenance, repair, storage, and the sale of outboard motors.Boating → Boat Maintenance 183 Marine & Watercraft → Water Transportation 446 engine 758 storage 2446 boat 2980 repair 14576 maintenance 20093 De Fryske Marren → Delfstrahuizen 47
huismansprinklertechniek.nlHuisman SprinklertechniekThe website of Huisman Sprinklertechniek is dedicated to informing visitors about and offering residential sprinkler systems as a means of enhancing fire safety in homes and vacation homes.Safety → Fire Safety 1048 Building Systems & Services → Mechanical Installation 80 water pipe 118 fire safety 589 installation 13742 De Fryske Marren → Joure 689
rommelmarktvinden.nlrommelmarktvinden.nlThe website provides a list of flea markets taking place during the weekend.Markets → Flea Markets 169 flea market 137 weekend 383 province 518 Land van Cuijk → Beugen 102
huismaninstallatieprofessionals.nlHuisman InstallatieprofessionalsHuisman Installatieprofessionals provides a wide range of installation services for new construction, renovations, and complex projects.Energy → Energy Saving 1151 Installation & Repair → General Installation 727 smart home 439 heat pump 2541 installation 13742 De Fryske Marren → Joure 689
de-vlaggenmaster.nlThe VlaggenmasterThe Vlaggenmaster is a webshop selling flagpoles, flags, and accessories.Advertising Materials → Flags 103 Home → Flagpoles 36 flagpole 57 flag 529 accessories 12975 De Fryske Marren → Mirns 22
theinteriorretreat.nlThe Interior Retreat LangweerThe Interior Retreat Langweer website offers an interior design platform where visitors can develop an interior plan for their home, apartment, or workspace, in collaboration with interior architects.Real Estate → Project Development 633 interior architecture 137 retreat 1638 apartment 5088 interior 8093 De Fryske Marren → Langweer 93
chaletsmakkum.nlChaletbemiddeling MakkumThe website Chalets-Makkum.nl offers chalets for rent and sale in the Makkum chalet park on the IJsselmeer.Boating → Marinas 825 chalet 1264 park 1863 holiday 2295 accommodation 4921 Southwest-Friesland → Hindeloopen 127
wijnkoperijbulthuis.nlWijnkoperij BulthuisWijnkoperij Bulthuis is a wine shop specializing in European quality wines and organizing personal wine tastings.Gifts & Souvenirs → Wine Shops 796 Culinary & Tastings → Tastings 127 wine shop 63 corporate gift 425 taste 933 wine 4476 De Fryske Marren → Echten 54
sieslingsolar.nlSiesling SolarSiesling Solar is a specialist in solar panel installations, offering advice and service in the West Friesland region.Installation & Repair → Energy Installers 83 roof 3662 solar panels 4701 house 8121 energy 9075 installation 13742 Medemblik → Andijk 242
decranberry.nlDe CranberryDe Cranberry is a delivery service for potatoes, vegetables, and fruit in the Heeg region.Food Delivery → Delivery 2227 Retail & Commerce → Commerce 8244 day 189 delivery service 236 potato 542 fruit 1166 vegetables 1416 store 3901 Southwest-Friesland → Heeg 227
alromotoren.nlAlro MotorenAlro Motoren is a specialist in the maintenance, repair, and sale of both outboard and inboard engines for recreational boating.Boats → Aluminum Boats 35 Marine & Watercraft → Boat Sales 144 engine 758 boat 2980 repair 14576 maintenance 20093 De Fryske Marren → Balk 224
kinderopvangnet.nlKinderopvangnet.nlKinderopvangnet.nl is a website that provides information on childcare locations throughout the Netherlands.Childcare → After-School Care 765 Childcare → Daycare Centers 987 kindcentrum 74 directory 176 daycare center 180 daycare 1365 childcare 3512 Sittard-Geleen → Munstergeleen 66
roelevinksport.nlRoelevink Sport VOFThe Roelevink Sport website offers judo classes for all ages, focusing on developing self-confidence, self-defense, strength, fitness, and resilience.Martial Art → Judo 389 motor skills 112 judo 375 strength 789 resilience 1091 self-confidence 1173 De Fryske Marren → Lemmer 1188
schilderwerkendoodeman.nlSchilderwerken DoodemanSchilderwerken Doodeman is a painting company located in West Friesland specializing in painting, spraying, wallpapering, and repair work, offering advice and free quotes.Painting → Professional Painting 153 spray 658 wallpaper 1756 warranty 4701 paint 8747 repair 14576 De Fryske Marren → Lemmer 1188
mrbdorusrijkers.nlStichting Instandhouding Motorreddingboot Dorus Rijkers 1923The website of the Stichting Instandhouding Motorreddingboot ‘Dorus Rijkers’ 1923 aims to provide information about the history, activities, and maintenance of this historic motor lifeboat.Foundations → Cultural Foundations 101 Marine & Watercraft → Ships 132 rescue 107 motorboat 128 sponsor 1159 trip 2032 boat 2980 history 7286 De Fryske Marren → Lemmer 1188
vriendenvanstichtingleergeldzwf.nlFriends of Stichting Leergeld ZWFThe website of Friends of Stichting Leergeld ZWF is focused on collecting financial support and volunteers to support the Stichting Leergeld ZWF in its work for young people in the municipalities of Fryske Marren and Sudwest Fryslan.Social Services → Youth Support 530 Initiatives & Projects → Organizations 2755 donor 757 young people 1045 municipality 6837 Southwest-Friesland → Sneek 1921
beautybrowsbymargriet.nlBeauty&Brows by MargrietThe website of Beauty&Brows by Margriet offers information about various cosmetic treatments for the face and eyebrows, performed by Margriet.Eyelash Services → Eyebrows 777 henna 74 eyebrows 1127 facial treatment 1152 salon 5541 treatment 21203 De Fryske Marren → Joure 689
directbeeld.nlLoodzwaar Media / DirectBeeld.nlThe website Direct Beeld specializes in live streaming and photo streaming of webcams and timelapse images, particularly for construction projects and events.Online Entertainment → Webcam Sites 14 Music → Streaming 170 timelapse 32 webcam 236 stream 684 photo 7778 De Fryske Marren → Joure 689
leuketeamuitjes.nlLeuke TeamuitjesThe website offers team outings that connect, inspire, and create impact.Corporate Events → Team Building 1005 Corporate Events → Corporate Outings 878 team outing 221 corporate outing 388 team building 720 sail 965 outing 982 The Hague → Scheveningen 1625
impacterdefryskemarren.nlImpacterImpacter is a project designed to support young people in De Fryske Marren in discovering their passions and pursuing their ambitions, while also contributing to the community.Initiatives & Collaboration → Initiatives 459 Youth → Projects 11 initiative 1297 coach 25810
grootdiving.nlGroot DivingGroot Diving is a diving wholesale company offering diving equipment, underwater work, and access to a diving museum.Diving → Diving Courses 214 oxygen 58 diving equipment 79 labor law 356 De Fryske Marren → Lemmer 1188
bjsolutions.nlBJ solutions B.V.The website of BJ solutions B.V. offers solutions for clothing transport, storage, and logistics, primarily aimed at dry cleaners.Logistics → Storage Solutions 116 Logistics → Warehouse Furnishing 57 mezzanine 33 storage 2446 logistics 3257 transport 6105 De Fryske Marren → Lemmer 1188
natuurenwelzijnbenningbroek.nlNatuur & Welzijn BenningbroekNatuur & Welzijn Benningbroek is an online animal shop specializing in fresh meat for dogs and cats, with a location in West Friesland.E-Commerce → Pet Supplies 1013 cat 1578 meat 2055 dog 5483 shop 6483 order 6912 De Fryske Marren → Lemmer 1188
administratiekantoorrobbakker.nlRob Bakker AdministratiekantoorAdministratiekantoor Rob Bakker is a financial advisory firm located in Andijk, offering accounting, bookkeeping, payroll administration, and advice to entrepreneurs and individuals in West-Friesland and the surrounding area, up to Amsterdam.Accounting → Bookkeeping 1230 Company & Business → Individuals 827 tax returns 423 payroll administration 979 bookkeeping 1319 subscription 3287 account 5781 De Fryske Marren → Lemmer 1188
wierdagroep.nlWierda GroepWierda Groep is a company that provides custom solutions for trucks, including sales, maintenance, repair, design, and construction.Auto Parts & Tires → Vehicle Parts 205 Maintenance & Services → Truck Maintenance 69 truck 1412 vehicle 3743 vacancy 6598 De Fryske Marren → Joure 689
oksewieltws.nlOksewiel TWSOksewiel TWS is a watersport business located in Terherne, Friesland, offering a wide range of services related to boats, including maintenance, repair, installation, and renovation.Business → Industry 36977 boat 2980 installation 13742 renovation 13849 repair 14576 maintenance 20093 De Fryske Marren → Terherne 98
sjuustjoure.nlSjuustSjuust Official Webshop is an online store selling gemstones, minerals, interior accessories, jewelry, and fashion accessories.Jewelry → Gemstones 451 Hobbies → Mineralogy 15 minerals 311 gemstone 856 shopping cart 1521 accessories 12975 De Fryske Marren → Joure 689
bijltelecom.nlBijl Telecom and Fiber Technology B.V.Bijl Telecom and Fiber Technology B.V. is a company specializing in fiber optic technology and civil engineering, primarily focused on the installation and maintenance of fiber optic connections for business clients.Radio & Communication → Telecommunications 1361 Technology & Innovation → Construction Technology 790 certified 32 fiber 167 welding 1051 installation 13742 De Fryske Marren → Lemmer 1188
lemmerjachtservice.nlQnautique Jachtservice LemmerThe website of Qnautique Jachtservice Lemmer provides professional yacht service, winter storage, and the sale of Suzuki outboard motors to individuals and businesses in the Lemmer area.Boating → Boat Maintenance 183 Marine & Watercraft → Watercraft 44 yacht service 21 suzuki 96 winter storage 182 boat 2980 maintenance 20093 De Fryske Marren → Lemmer 1188
spw-media.nlSpw-MediaThis website provides information and media related to motorsport, specifically events, photos, and videos of the KNMV and VTBM.Associations → Sports Associations 1082 Motor → Motorsport 1438 rider 594 calendar 1556 video 6714 photo 7778 event 45199 Het Hogeland → Uithuizen 187
tpblaauwhof.nlTandartspraktijk BlaauwhofTandartspraktijk Blaauwhof in Joure provides dental care to patients of all ages.Local Communities → Villages 1005 teeth 680 patient 4082 practice 9089 treatment 21203 De Fryske Marren → Joure 689
jissinkschilderwerken.nlHein Jissink SchilderwerkenThe website of Hein Jissink Schilderwerken presents a painter from Balk, Friesland, specializing in painting, wall finishing, and glazing for private customers in the surrounding area.Bathrooms & Plumbing → Home Improvement 7367 wall finishing 310 glazing 482 paint 8747 De Fryske Marren → Balk 224
meerenopmaat.nlMeer en Op MaatThe website of 'Meer en Op Maat' offers the rental and manufacturing of colorful picnic tables and lounge benches, with a focus on customization and delivery throughout the Netherlands and Belgium.Nature & Outdoors → Outdoor 4031 lounge bench 12 picnic table 52 durability 366 customization 1723 transportation 2851 design 27202 De Fryske Marren →  Rotsterhaule 19
kevinkok.nlKevin Kok Driving SchoolThe website of Kevin Kok Driving School provides information on driving lessons, registrations, and offers for driving lessons with a high success rate, specifically targeted at the West Friesland region and surrounding areas.Driver’s License → Theory Courses 274 Context 161394 trailer 1624 exam 2120 driving lessons 2453 car 10865 training 28133 De Fryske Marren → Lemmer 1188
praktijkinjeelement.nlPraktijk In Je Element Nienke van der GrijnShiatsu practice ‘In je Element’ in Joure offers shiatsu and reflexology treatments for various ailments and health issues.Alternative Medicine → Energy Medicine 988 Alternative Medicine → Shiatsu 830 headache 182 shiatsu 578 balance 4582 energy 9075 De Fryske Marren → Joure 689
schilderwerken-kdejong.nlK. de Jong SchilderwerkenK. de Jong Schilderwerken provides painting and wallpapering services, including advice, for homes in Joure and surrounding areas.Maintenance & Services → Facade Maintenance 673 woodwork 387 wall 1378 facade 1490 paint 8747 renovation 13849 De Fryske Marren → Joure 689
amarbv.nlAmar B.V.Amar B.V. is a Dutch supplier of natural stone and ceramic tiles offering custom solutions for private and business customers.Kitchen Components → Countertops 111 Stone & Tiles → Natural Stone 199 tiler 51 custom solution 179 natural stone 614 tile 2869 workshop 19325 De Fryske Marren → Lemmer 1188
carcleaningbalk.nlCar Cleaning BalkThe Car Cleaning Balk website provides services for cleaning and polishing cars, aiming to inform and serve customers for vehicle maintenance.Maintenance & Services → Car Care & Detailing 1666 polish 269 wax 711 cleaning 4567 paint 8747 car 10865 De Fryske Marren → Balk 224
gitaarles-lemmer.nlGitaarles LemmerThe website Gitaarles Lemmer provides personalized guitar lessons in Lemmer and the surrounding area, catering to beginners and advanced players of all ages.Music Education → Guitar Lessons 403 guitar lesson 306 guitar 1091 lesson 5154 student 7623 music 13170 De Fryske Marren → Lemmer 1188
headroom-joure.nlHeadroomHeadroom barber shop in Joure offers hairdressing services including cutting, coloring, and the sale of products.Men’s Grooming → Barbershops 1012 Wellness → Stylists 244 barbershop 512 cut 926 coffee 3838 music 13170 De Fryske Marren → Joure 689
jmfruitpakketten.nlJM FruitpakkettenJM Fruitpakketten offers customized fruit baskets and boxes for businesses and individuals in West Friesland.Human Resources → Wellness Programs 319 Produce & Vegetables → Fruit 801 workplace 1046 fruit 1166 box 1982 logo 4660 package 6112 De Fryske Marren → Lemmer 1188
kuipervandermeer.nlKuiper & van der MeerThe website of Kuiper & van der Meer is an online portal of a timber and construction company located in Katlijk, specializing in new construction, renovation, interior construction, and glass installations in the Heerenveen region.Outdoor Living → Verandas 497 Business → Construction 72699 glass 2919 construction 7421 interior 8093 garden 13129 renovation 13849 De Fryske Marren → Lemmer 1188
metselbedrijfduan.nlMetselbedrijf Duan b.V.The website of Metselbedrijf Duan presents the company as a masonry contractor offering complete masonry packages, including plastering, scaffolding and pointing, and executing projects for various clients.Masonry & Plastering → Masonry 576 masonry 460 scaffolding 519 crane 662 plaster 2175 De Fryske Marren → Balk 224
pedicurenagelstudioiris.nlMedisch Pedicure and Nail Studio Iris CreilThe website of Medisch Pedicure and Nail Studio Iris Creil presents the services of a foot and nail treatment, with a focus on medical pedicure and specializations for people with diabetes, rheumatism, oncological feet and other foot problems. In addition, nail treatments with Bio Sculpture Gel are offered.Foot Care → Medical Foot Care 710 diabetic foot 66 foot treatment 97 nail treatment 230 nail studio 251 footcare 767 Noordoostpolder → Emmeloord 1649
rijschoolcornelique.nlRijschool CorneliqueRijschool Cornelique provides driving lessons and driving education, with a focus on a safe and pleasant learning experience for students, particularly those with autism or ADHD.Driving & Vehicle → Vehicle Training 553 driving instructor 252 driver's license 1283 driving lessons 2453 transportation 2851 education 13471 Noordoostpolder → Emmeloord 1649
taxitour.nlTaxitour HoornThe Taxitour Hoorn website offers a reliable and exclusive taxi service in Hoorn and West-Friesland, catering to various transportation needs, including airport transfers, business transportation, care transport, and luxury travel.Public Transportation → Regional Transportation 92 Taxi & Ride Services → Taxi 1062 airport 789 ride 1075 taxi 2090 price 8328 care 12338 De Fryske Marren → Lemmer 1188
klassiekinwf.nlStichting KarakteristiekThe website Karakteristiek Klassiek presents a new concert program featuring classical music, hosted in the Cultureel Centrum Pancratius in Oosterblokker, with the goal of introducing the public, especially young and old, to the world of music.Coaching → Vocal 61 Protestantism → Churches 1009 concert schedule 23 church building 160 concert 4409 foundation 6678 child 11566 music 13170 De Fryske Marren → Lemmer 1188
stichtingmilou.nlStichting MilouThe Stichting Milou aims to enhance the life of Milou using all available means.Sports Clubs → Gymnastics 481 trampoline jumping 12 foundation 6678 photo 7778 De Fryske Marren → Joure 689
vanwenstotbaby.nlVan Wens tot BabyVan Wens tot Baby provides services related to fertility, pregnancy, and childbirth, targeting parents in West Friesland and surrounding areas.Health → Pregnancy & Childbirth 4222 fertility 289 midwife 553 participant 1934 pregnancy 2739 parent 4318 Schagen → Tuitjenhorn 382
bedrijfsrondvaart.nlBedrijfs rondvaart .nlThe website offers boat tours and cruises for businesses and individuals along various waterways in the Netherlands, with options such as dinner cruises, high tea tours and themed trips.Water Travel → Boat Tours 640 Family Activities → Day Trips 419 boat tour 94 cruise 405 high tea 585 dinner 1533 trip 2032 destination 2580 Zevenaar → Lathum 89
buitensex-locaties.nlbuitensex-locaties.nlThe website provides locations in the Netherlands where discreet sexual encounters in nature are possible.Crime & Safety → Crime 356 Law → Criminal Law 1803 webcamsex 12 parking lot 75 Northeast-Friesland → Dokkum 846
volleybal-oudehaske.nlVolleybal Vereniging OudehaskeThe website of Volleybal Vereniging Oudehaske provides information about the association, its activities, members, and contact details.Associations → Sports Associations 1082 volleyball 617 tournament 2476 association 8562 training 28133 De Fryske Marren → Oudehaske 49
vakantievillamarkermeer.nlLuxe Vakantie Villas MarkermeerLuxe Vakantie Villas Markermeer is a vacation destination offering luxurious chalets for rent on the Markermeer in Bovenkarspel.Holiday Homes → Luxury Vacation Rentals 44 Accommodation → Cottages 298 resort 279 stay 702 chalet 1264 villa 1351 nature 9094 De Fryske Marren → Lemmer 1188
nanningsoccasions.nlNannings OccassionsNannings Occasions is an automobile dealership located in West-Friesland specializing in the sale of used cars from top brands.Cars → Convertibles 20 mercedes 113 dealership 292 bmw 344 used cars 894 car 10865 Opmeer → Hoogwoud 149
hulpbijhoren.nlHulp bij Horen RealisatieThe website ‘Hulp bij Horen Realisatie’ offers hearing protection, hearing aids, and related accessories, and provides an appointment scheduling service. Additionally, TV solutions, telephony and mobile phones are offered.Hearing Problems → Hearing Aids 110 Services → Opticians 551 hearing aid 80 hearing protection 107 accessories 12975 appointment 13510 De Fryske Marren → Lemmer 1188
deverlossingvangroningen.nldeverlossingvangroningen.nlThis website presents a feuilleton (serialized story) about Hugo Middelbron, the inventor of Bitcoin, and the potential consequences of his anonymous life.Investing → Cryptocurrency 776 Crime & Safety → Crime 356 anonymous 23 bitcoin 359 farmhouse 878 De Fryske Marren → Broek 21
skikmedia.nlSKIK MediaThe website of SKIK Media presents the services of a marketing agency that helps businesses establish an online presence, focusing on websites, social media management, and online advertising.Online Marketing → Social Media Management 696 visibility 590 advertisement 1707 social media 3342 brand 17737 De Fryske Marren → Lemmer 1188
bedandbreakfastweerribbenwieden.nlBedandbreakfast2WittekatersThe website of Bedandbreakfast2Wittekaters presents a bed and breakfast located near the Weerribben-Wieden National Park and Giethoorn, offering two unique accommodation options: a traditional Dutch private house and a gardenhouse, and allowing guests to experience the peace and beauty of the surroundings.Nature → Nature Reserves 1032 Nature → National Parks 898 national park 98 bed & breakfast 319 reviews 3172 terrace 4847 environment 4873 house 8121 Steenwijkerland → Giethoorn 565
frankemavastgoed.nlFrankema VastgoedFrankema Vastgoed is a real estate company specializing in the rental of commercial space and offices, with locations in Lemmer.Commercial Property → Retail Space 107 Commercial Properties → Offices 773 commercial space 245 listings 525 complex 568 office space 773 rental 7257 De Fryske Marren → Lemmer 1188
weekendjeweg-drenthe.nlWeekendjeweg-drenthe B.V.The website weekendjeweg-drenthe.nl provides an overview of holiday homes and holiday cottages in the Drenthe region, both privately offered and on holiday parks, with the aim of helping holidaymakers find a suitable accommodation for a weekend or longer stay.Accommodation → Holiday Cottages 146 Europe → Czech Republic 42 holiday cottage 62 holiday home 2753 accommodation 4921 nature 9094 Aa en Hunze → Gasselternijveen 68
zeewolf.nlDuikvereniging 'de Zeewolf'The website of the 'De Zeewolf' Diving Club provides information about the club, its activities, and the opportunities for diving courses and recreational diving in the Casteleijnsplas.Diving → Diving Clubs 142 Diving → Diving Courses 214 diving club 55 diving course 115 clubhouse 784 De Fryske Marren → Lemmer 1188
schildersbedrijfkampen.nlSchildersbedrijf KampenSchildersbedrijf Kampen is a painting company that serves both private and commercial clients and specializes in painting, wall coverings, and glass service.Windows → Glazier 440 Finishing & Trades → Building Trades 112 glass service 19 wall coverings 60 color consultation 100 paint 8747 renovation 13849 De Fryske Marren → Sint Nicolaasga 146
wagnerinstallatietechniek.nlWagner InstallatietechniekWagner Installatietechniek is an installation company that installs, replaces, and maintains heat pumps, boilers, air conditioning, and ventilation systems in West-Friesland.Heating → Central Heating Installation 294 Energy & Sustainability → HVAC (Heating 198 ventilation 1110 boiler 1240 air conditioning 2178 heat pump 2541 installation 13742 maintenance 20093 De Fryske Marren → Lemmer 1188
hovenierhollaar.nlHoveniersbedrijf HollaarHoveniersbedrijf Hollaar is a landscaping company that offers a range of garden maintenance services, from design and installation to maintenance and renovation.Outdoor & Garden → Garden Businesses 108 garden 13129 installation 13742 maintenance 20093 design 27202 De Fryske Marren → Joure 689
dtvagritech.nlDTV AgritechThe DTV Agritech website offers a comprehensive selection of agricultural tools, spare parts, feeding technology, and other products for agricultural and gardening management.Garden Maintenance → Lawn Maintenance 166 Machinery & Repair → Tractors 266 soil preparation 10 mowers 39 wood pellets 105 spare parts 153 De Fryske Marren → Sint Nicolaasga 146
sudwestacademie.nlSúdwest academieThe Súdwest academie offers a training program for entrepreneurs and executives focused on sustainable business practices and creating a positive impact.Professional Development → Training Programs 129 Business & Economy → Sustainable Business 226 impact 926 entrepreneurship 1579 inspiration 4081 sustainability 18451 Friesland → Southwest-Friesland 4194
basisschool-gids.nlBasisschool OverzichtThis website provides an overview of elementary schools (basisscholen) in the Netherlands. It’s a directory that lists schools in various provinces and municipalities, allowing users to easily search for a suitable elementary school.Office & Workspace → Business Directories 421 elementary school 82 overview 329 province 518 compare 582 municipality 6837 research 8967 Borsele → 's-Gravenpolder 94
skotsetrije.nlSkotsetrije ScheepstimmerwerkThe website of Skotsetrije Scheepstimmerwerk presents the shipbuilding company of Eef Bruinsma in Warns, Friesland, specializing in the restoration and renovation of wooden ships and yachts.Maritime → Shipyard 59 yacht service 21 shipbuilding 148 deck 268 yacht 647 harbor 691 restoration 3417 Southwest-Friesland → Stavoren 155
jelmerskaasspeciaalzaak.nlJelmer's KaasspeciaalzaakJelmer's Kaasspeciaalzaak is a cheese shop specializing in the sale of cheese, primarily Klaver-Kaas cheese, and offers various supplementary products and services.Dairy → Cheese 530 fondue 33 cheese 1205 wine 4476 De Fryske Marren → Lemmer 1188
weelbouw.nlWeel ConstructionThe website of Weel Construction presents a family-run construction business specializing in various building projects, including new construction, extensions, renovations, and restorations, from small jobs to complete buildings.Construction Companies → Construction Contractors 536 Building & Construction → Renovation 4403 contracting company 13 construction project 701 new construction 2672 restoration 3417 renovation 13849 De Fryske Marren → Lemmer 1188
nlclubsdata.nlNK Clubs RankingThe website provides a ranking of Dutch ice clubs and hard ride clubs.Team → Speed Skating 122 Sport Organization → Hockey 550 ranking 149 club 4225 performance 7586 De Fryske Marren → Sint Nicolaasga 146
feestuitjeenkhuizen.nlEenhoorn EvenementenThe website Feestuitjeenkhuizen.nl offers a selection of diverse outings and events in Enkhuizen, targeting private groups and businesses.Family Activities → Outings 763 Corporate Events → Corporate Outings 878 theme party 143 corporate outing 388 outing 982 tours 1048 arrangement 3104 event 45199 De Fryske Marren → Lemmer 1188
petravanwesting.nlPeet’s Yoga & CoachingThe website of Peet’s Yoga & Coaching presents a yoga studio and coaching practice located in Goingarijp, Friesland, offering various yoga styles and massage therapies, as well as yoga retreats and personal coaching.Yoga → Yoga Classes 168 Mind & Body → Retreats 1003 breath 209 retreat 1638 body 3490 yoga 3704 massage 7646 coach 25810 De Fryske Marren → Goingarijp 86
stichting-projector.nlStichting ProjectorThe Stichting Projector collects and manages visual material about the West Friesland region.Urban History → Local History 1654 Monuments → Cultural Heritage 514 visual material 38 image bank 88 presentation 1785 De Fryske Marren → Lemmer 1188
kuperusheeringa.nlKuperus Heeringa MakelaardijKuperus Heeringa Makelaardij presents various homes and estates for sale in the Sneek, IJlst, Heeg and surrounding area.House Types → Houses 2546 Property Valuation & Appraisal → Regional Real Estate Agents 454 canal 507 farmhouse 878 plot 1051 house 8121 garden 13129 Southwest-Friesland → Heeg 227
mkb-lonen.nlMKB Administraties & LonenThe website of MKB Administraties & Lonen presents the accounting firm based in Langweer and surrounding areas, offering information about the services they provide.Company & Business → Individuals 827 Government & Legal → Tax 1322 tax advisory 134 accounting firm 250 administration 6587 De Fryske Marren → Langweer 93
slapenopeenhouseboat.nlSlapen op een houseboatThe website ‘Slapen op een houseboat’ provides information and booking options for a stay on a houseboat located on the Sneekermeer, focused on recreation and relaxation.Water Recreation → Houseboats 36 sneekermeer 14 houseboat 130 watersport 540 De Fryske Marren → Goingarijp 86
leafsutbalk.nlLeafs ut BalkLeafs ut Balk is a concept store offering a curated selection of decorative gifts, home accessories, and baby clothing, emphasizing products from trendy brands and a personalized feel.Children’s Clothing → Baby Clothing 604 Crafts → Handmade 1147 baby clothing 309 home accessories 603 inspiration 4081 gift 6442 brand 17737 De Fryske Marren → Balk 224
fietsenhurenhoorn.nlFietspoint RuiterFietspoint Ruiter is a bicycle rental company in Hoorn that rents bicycles and e-bikes for excursions in the region.Cycling → Bicycle Rental 643 tandem 55 deposit 135 station 420 e-bike 908 bicycle 2838 reservation 3373 De Fryske Marren → Lemmer 1188
makelaar-westfriesland.nlEsther van Dijk MakelaardijEsther van Dijk Makelaardij is a real estate and appraisal agency based in West-Friesland, offering various services including house sales, purchasing assistance, appraisals, and sustainability advice.Property Finance → Supplies 65 Property Valuation & Appraisal → Appraisers 315 appraisal 1488 real estate 4981 house 8121 sustainability 18451 De Fryske Marren → Lemmer 1188
landgoedrijs.nlLandgoed RijsLandgoed Rijs is a estate offering accommodations, events, weddings, and meetings.Venues & Rentals → Venues 2044 Nature → Estates 771 estate 1099 wedding 4258 event 45199 De Fryske Marren → Rijs 32
hillygaia-coaching.nlHilly Gaia-CoachingThe website of Hilly Gaia-Coaching offers coaching and healing services to women, teenagers, and children, with a focus on personal growth, restoring balance, and discovering inner strength.Trauma & Recovery → Grief 907 essential oil 428 poem 1014 healing 1148 workshop 19325 coach 25810 De Fryske Marren → Lemmer 1188
melissapander.nlMelissa PanderThe website of Melissa Pander features her tour dates, new singles, and provides a way to contact her.Performance → Dutch Musicians 73 Music → Dutch Language Music 74 single 445 concert 4409 music 13170 De Fryske Marren → Oudemirdum 73
bknoptrans.nlB&K NoptransB&K Noptrans is a company that provides paving, road construction, and groundwork services.Garden → Paving 1003 road construction 216 groundwork 1348 paving 1942 De Fryske Marren → Lemmer 1188
jhenf.nlJan Heida Advies en FinanceJan Heida Advies en Finance is a financial advisory firm that provides support to entrepreneurs, particularly in the healthcare sector.Stock Trading → Investing 4298 Management → Financial Management 910 forecast 119 controller 239 business plan 387 financial advice 605 healthcare 2316 De Fryske Marren → Bantega 19
terschure.nlLandbouwmechanisatie ter SchureThe website of Landbouwmechanisatie ter Schure presents a farm machinery business based in Oosterzee, Friesland, that deals with the sale, rental, and service of agricultural machines, garden and park machinery, and used equipment.Agriculture → Agricultural Machinery & Equipment 631 equipment 4143 rental 7257 garden 13129 De Fryske Marren → Oosterzee 29
reparatiebedrijfdevries.nlReparatiebedrijf de VriesReparatiebedrijf de Vries is a garage specializing in repairs and maintenance of various vehicles and machines, with a focus on finding solutions for difficult repairs.Metalworking → Welding 893 Road Services → Road Transport 400 agricultural vehicle 18 turn 226 repair 14576 maintenance 20093 De Fryske Marren → Oosterzee 29
fietsverhuurburgum.nlFietsverhuur BurgumFietsverhuur Burgum is a bicycle rental company that rents electric bikes in and around Burgum, offering bicycle delivery and providing cycling routes.Cycling → Electric Bikes 445 Cycling → Bicycle Rental 643 nature area 497 e-bike 908 bike 1541 reservation 3373 route 3425 Leeuwarden → Oud Oost 61
dereefhorst-jaguar.nlJaguar De ReefhorstJaguar De Reefhorst is an official Jaguar dealer that sells new and used cars and provides service.Cars (Brands) → Jaguar 23 jaguar 43 inventory 1613 warranty 4701 car 10865 De Fryske Marren → Oudehaske 49
tinecommunicatie.nlTine CommunicatieTine Communicatie offers funeral speaking and writing training services, focused on supporting people in difficult times and fostering creative writing.Design & Projects → Self-Employed Entrepreneurs 505 Communication → Writing 2954 writing training 27 funeral speaker 29 farewell 1109 life 2673 energy 9075 De Fryske Marren → Harich 35
cultuurvrijwilligers.nlCultuurvrijwilligersThe website Cultuurvrijwilligers.nl connects volunteers with cultural events and organizations in Friesland, and provides a platform for posting volunteer vacancies.National Identity → Regional Culture 177 friesland 692 volunteer 8367 event 45199 Waadhoeke → Franeker 694
cabkdesign.nlC.A.B.K. designThe website of C.A.B.K. design presents a company specializing in custom manufacturing using 3D printing and laser cutting, catering to diverse applications from prototypes to mass production.Manufacturing → 3D Printing 565 Manufacturing → Laser Cutting 137 autocad 57 laser cutting 251 3d printing 332 manufacturing 396 prototype 603 design 27202 De Fryske Marren → Oudehaske 49
laacademia.nlLa AcademiaLa Academia offers Spanish courses in West Friesland and informs visitors about course availability and study trips.Language Courses → Spanish 180 Europe → Spain 1316 spanish 125 speaking 217 facebook 850 instagram 1216 course 14728 De Fryske Marren → Lemmer 1188
freulefroukje.nlFreule Froukje JoureThe website of Bed and Breakfast Freule Froukje in Joure presents the accommodation and provides information about rooms, rates, photos, the surrounding area, and contact details.Water Travel → Boat Tours 640 Nature → National Parks 898 boat trip 184 friesland 692 wifi 1372 breakfast 1822 room 3411 garden 13129 De Fryske Marren → Joure 689
goedinvastgoedbelegging.nlGoedin Vastgoed Belegging B.V.The website Goedinvastgoedbelegging.nl offers staff housing in various locations throughout the Netherlands.Commercial Property → Commercial Space 489 Social Services → Caregiving 722 bungalow 687 apartment 5088 property 7406 Southwest-Friesland → Makkum 229
wftc.nlWest-Fries Taekwon-do CenterThe West-Fries Taekwon-do Center is a taekwon-do club in Westfriesland that has been active for 40 years and offers lessons for all ages and levels.Martial Art → Taekwondo 130 Sports & Fitness → Sports Programs 367 taekwondo 144 exercises 1058 club 4225 competition 4759 De Fryske Marren → Lemmer 1188
bosmaballooning.nlBosma BallooningThe website of Bosma Ballooning presents a company that organizes hot air balloon rides in the Netherlands, providing information on locations, booking options, opportunities to learn how to fly a balloon, and contact details.Adventure → Hot Air Ballooning 93 balloon ride 24 balloon 554 family business 793 weather 817 instructor 3126 De Fryske Marren → Goingarijp 86
gelcoatreparaties.nlCSI LemmerThe CSI Lemmer website provides services related to repairs and production work in the field of composites, particularly polyester and gelcoat, and offers solutions for damage repair on yachts and various projects.Repair → Mobile Phone Repair 1012 Maritime → Shipyard 59 repair work 15 silo 96 polyester 101 yacht 647 production 4582 De Fryske Marren → Lemmer 1188
salaattijden.nlSalaat TijdenThe website provides Islamic prayer times for various cities in the Netherlands.Religion → Islam 542 News & Journalism → Regional News 948 prayer 397 time 932 city 1875 region 5412 Velsen → Velsen-Zuid 121
faberjoure.nlFaber Joure B.V.Faber Joure B.V. provides industrial service and transport services, including the transport, assembly, and disassembly of machinery and production lines.Logistics & Transport → Logistics 7444 Context → Transportation 39459 production line 124 machinery 519 crane 662 assembly 1733 transport 6105 De Fryske Marren → Joure 689
passend-interieur.nlPassend InterieurPassend Interieur is an interior construction company that designs, produces, and installs custom interiors for both business and private clients.Finishing & Trades → Interior Construction 502 production 4582 interior 8093 installation 13742 design 27202 De Fryske Marren → Joure 689
veza.nlAutobedrijf VezaThe website of Autobedrijf Veza presents the services of an automobile dealership in Wognum, West-Friesland, including car sales, maintenance, repair, tire service, and financing.Tires → Tire Service 931 Automotive Maintenance → Vehicle Inspection 1102 apk 1333 tire 1975 air conditioning 2178 car 10865 repair 14576 maintenance 20093 De Fryske Marren → Lemmer 1188
sip-jantuin.nlSip-jan Tuin & OnderhoudSip-jan Tuin & Onderhoud is a TuinKeur-certified landscaping company offering services for garden design, maintenance, and related tasks.Garden Maintenance → Gardeners 685 Green Spaces → Green Maintenance 449 soil 930 fence 1814 tree 1879 garden 13129 maintenance 20093 design 27202 Southwest-Friesland → Sneek 1921
gcdemarne.nlGezondheidscentrum De MarneGezondheidscentrum de Marne in Leens provides general medical care, physiotherapy, and youth support services.Digital & Telehealth → Patient Portals 329 medical care 85 youth support 125 prescription 859 physiotherapy 4688 appointment 13510 Het Hogeland → Leens 104
partyverhuurenkhuizen.nlPartyverhuur EnkhuizenThe website of Partyverhuur Enkhuizen offers a wide range of rental items for parties and events, with a focus on bouncy castles, inflatable figures, and other party supplies.Family Activities → Children’s Entertainment 571 Outdoor → Play Equipment 313 balloon decoration 62 inflatable figure 109 party rental 124 bouncy castle 366 treat 373 De Fryske Marren → Lemmer 1188
demannenkapperjoure.nlDe Mannenkapper JoureThe website of De Mannenkapper Joure offers barbering services for men in Joure, with a focus on honesty and familiarity.Men’s Grooming → Barbershops 1012 Beauty → Cosmetic Procedures 1147 barber 418 beard 468 haircut 1158 appointment 13510 De Fryske Marren → Joure 689
praktijkoudehaske.nlHousecall Practice OudehaskeThe website of Housecall Practice Oudehaske provides information about the practice, appointments, staff, and digital facilities for patients.Ambulatory & House Calls → House Calls 46 blood test 200 doctor 1397 practice 9089 care 12338 appointment 13510 De Fryske Marren → Joure 689
vrijinbewegen.nlVrij in BewegenVrij in Bewegen is a practice offering physiotherapy, manual therapy, dry needling, and hand therapy in and around Lemmer, Friesland.Rehabilitation → Occupational Therapy 380 Medicine → Physiotherapy 2372 haptonomy 121 hand therapy 128 dry needling 424 manual therapy 1320 physiotherapy 4688 De Fryske Marren → Lemmer 1188
overall-design.nlOverall Design Projects BVOverall Design Projects BV is a full-service agency specializing in the design and execution of trade show booths and interior projects, with a focus on European and American markets.Event Management → Event Marketing 496 trade show booth 10 planning 1969 concept 3338 production 4582 transport 6105 interior 8093 De Fryske Marren → Joure 689
rsowf.nlRijke School Omgeving West-FrieslandThe website of Rijke School Omgeving West-Friesland presents activities and projects aimed at promoting equal participation of young people in society.Youth Development → Youth 1033 Special Needs & Support → Educational Support 2195 initiative 1297 participation 1430 youth 3126 school 7856 De Fryske Marren → Lemmer 1188
ludze-uitvaartzorg.nlLudze UitvaartzorgLudze Uitvaartzorg is a funeral services provider that offers personalized and flexible services to families following the loss of a loved one.Death → Funerals 552 Legal → Legal Issues 56 bereaved 291 approach 971 farewell 1109 funeral 2477 De Fryske Marren → Joure 689
mecanorth.nlMeca NorthThe website of Meca North offers various industrial services, including machine construction, maintenance, repair, the deployment of freelancers (ZZP), and project management, with a focus on sustainable partnerships and high-quality solutions.Industrial Equipment & Services → Machine Building 665 Maintenance & Services → Machine Maintenance 262 machine construction 146 freelancer 877 project management 3423 repair 14576 maintenance 20093 De Fryske Marren → Joure 689
taxijack.nlTaxi JackThe Taxi Jack website is a taxi company providing taxi and catering transport services in the Friesland region, with a focus on safety, comfort, and sustainability.Transport Companies → General Transportation 61 Taxi & Ride Services → Taxi 1062 friesland 692 ride 1075 taxi 2090 book 11396 De Fryske Marren → Lemmer 1188
hannekeschmeink.nlHanneke Schmeink RECREATIEHanneke Schmeink RECREATIE provides independent research, advice, and project management in the leisure sector.Social Issues → Community Development 330 Visual Arts → Museums 2049 spatial 12 recreation 799 vision 1882 hospitality 3491 Het Hogeland → Lauwersoog 295
pleinjoure.nlPlein JoureThe Plein Joure website serves as an informative resource for parents, students, and visitors, providing details about the school’s education, activities, contact information, and registration process.Primary Education → Public Education 424 Curriculum & Resources → Educational Information 33 leave 84 introduction 277 fee 640 schedule 2624 education 13471 De Fryske Marren → Joure 689
makelaargaasterland.nlMakelaar in GaasterlandThe website of ‘Makelaar in Gaasterland’ is a real estate agency specializing in the sale of properties in the higher price segment in the region of Gaasterland, Southwest Friesland.Property Agents & Brokers → Brokers 356 Context 161394 segment 62 buyer 233 luxury 375 villa 1351 sale 5930 property 7406 Southwest-Friesland → Koudum 134
makelaarinlemmer.nlMakelaar LemmerThis real estate agent's website focuses on the sale of luxury homes and properties on the water in the De Friese Meren region, specifically targeting the higher segment of the market.Real Estate & Investment → Real Estate 21471 segment 62 water 2501 wishes 2717 home 7976 strategy 9379 communication 10162 De Fryske Marren → Lemmer 1188
martinuskerk-oosterzee.nlMartinuskerk OosterzeeThe website of the Martinuskerk Oosterzee describes how the church building, since 2012, has been used as a residence and the events and gatherings that take place here.Protestant Churches → Church Buildings 69 History & Culture → Organ Tradition 19 church building 160 residence 251 conversation 1828 music 13170 event 45199 De Fryske Marren → Oosterzee 29
flexbloqs.nlBruZan OntwikkelingFlexBloqs offers various space solutions, both for business and private use, to customers in the Netherlands.Logistics → Storage 1170 Services → Personal Services 1062 stall 193 storage space 388 unit 405 showroom 4883 Leeuwarden → Grou 366
cafehetwapenvanfriesland.nlCafé Het Wapen van FrieslandCafé Het Wapen van Friesland is a café and terrace in Sint Nicolaasga, Friesland, offering various activities and amenities.Cafes → Grand Cafés 228 Outdoor → Terraces 188 lunch 1534 cafe 1622 terrace 4847 party 5928 event 45199 De Fryske Marren → Sint Nicolaasga 146
kwalitas.nlBureau KwalitasBureau Kwalitas provides financial and tax assistance to users of care in the Netherlands.Budgeting → Budget Management 165 Legal → Guardianship 879 financial affairs 25 allowance 163 guardianship 767 tax return 787 subscription 3287 care 12338 De Fryske Marren → Lemmer 1188
rebruck.nlMeubel restylen & woonaccessoires Joure - RebrûckThe website offers furniture restyling and home accessories, reusing old furniture and combining it with new items.Interior Design → Interior Consulting 615 Repair → Furniture Repair 259 restyle 97 color 4159 paint 8747 furniture 8751 accessories 12975 De Fryske Marren → Joure 689
delemster.nlDe LemsterThe website ‘De Lemster’ publishes news and information about the municipality of Lemmer and the surrounding region.Local News → Municipal News 153 Local & Regional → Local News Websites 358 weather 817 guide 1364 community 7931 energy 9075 news 15293 event 45199 De Fryske Marren → Lemmer 1188
bioregionh.nlVereniging Bio-NHThe BioFieldlab Noord-Holland is an innovation hub focused on the development and strengthening of the organic sector, with a focus on collaboration, sustainability, and regional goals.Agriculture → Organic Farming 560 Agricultural Technology & Innovation → Sustainable Agriculture 278 organic agriculture 12 knowledge exchange 15 innovation 4659 collaboration 16036 sustainability 18451 De Fryske Marren → Lemmer 1188
sportparkkeepmoving.nlSportpark Keep MovingSportpark Keep Moving is a location specializing in various outdoor sports, particularly calisthenics, obstacle run, and bootcamp, focused on a fun and active sports experience in the fresh air.Running → Trail Running 133 Group Class → Bootcamp 208 calisthenics 21 obstacle run 30 group lesson 117 obstacle 204 bootcamp 497 course 14728 De Fryske Marren → Lemmer 1188
solexclubaow.nlSolexclub AOWThe Solexclub AOW is a Dutch club that organizes tours and shares solex experiences with enthusiasts.Planning → Tours 870 solex 61 tours 1048 club 4225 member 10154 De Fryske Marren → Joure 689
djceesweel.nlDJ Cees WeelThis website presents DJ Cees Weel, a DJ who provides services for parties and events in the West Friesland region and surrounding areas, offering a broad musical selection from classic hits to contemporary tunes.Events & Venues → DJs 1001 dj 1722 equipment 4143 party 5928 music 13170 event 45199 De Fryske Marren → Lemmer 1188
stadenlandschap.nlStad & LandschapThe website of Stad & Landschap presents projects in the fields of urban planning, landscape design, and public space, with a focus on integrated development visions and the transformation of existing and new environments.Urban Planning → Public Space 188 public space 137 urban planning 273 landscape 2609 De Fryske Marren → Balk 224
slapeninoudehaske.nlMini-Camper Camping - OudehaskeThe website of Mini-Camper Camping - Oudehaske presents a small campsite in Friesland, focused on relaxation, enjoyment of nature, and exploring the surrounding environment.Camping → Campsites Netherlands 792 Nature → National Parks 898 pipowagen 25 caravan 1394 campsite 2093 relaxation 3968 environment 4873 nature 9094 De Fryske Marren → Joure 689
warena.nlCoöperatieve Vereniging U.A. WaReNaWaReNa is a recreational park that provides 60 plots to its members for recreational purposes.Boating → Marinas 825 Governance → Law 14133 nature lovers 13 buildings 898 plot 1051 facility 2616 association 8562 De Fryske Marren → Oudehaske 49
marjonvanbaar.nlMarjon van BaarThe website of Marjon van Baar offers ritual guidance for farewell ceremonies, focused on creating personal and meaningful moments for bereaved families.Social Services → Grief Support 587 Funeral Services → Funeral Arrangement 486 symbolism 97 ritual 506 ceremony 824 farewell 1109 comfort 1473 story 8285 De Fryske Marren → Lemmer 1188
epoxyvloerhoorn.nlEpoxyVloer HoornEpoxyVloer Hoorn is a specialist providing high-quality epoxy flooring solutions for private and business clients in Hoorn and the surrounding area.Interior → Flooring 2791 Commercial & Industrial Solutions → Commercial Facilities 21 epoxy floor 35 floor 4781 quote 12863 De Fryske Marren → Lemmer 1188
hoornelektricien.nlHoorn ElektricienThe website Hoorn Elektricien offers professional electrician services in Hoorn and surrounding areas, with a focus on safety and reliability.Technical Services → Technical 957 Context 161394 electrician 819 panel 868 installation 13742 repair 14576 De Fryske Marren → Lemmer 1188
loodgieterhoorn24.nlLoodgieter Hoorn 24Loodgieter Hoorn 24 is a plumber and CV (central heating) installer providing services in Hoorn and the surrounding area, with a particular focus on West-Friesland.Repair → Plumbing Repair 47 emergency 750 plumber 1210 plumbing 1761 heat 2188 roofing 2806 De Fryske Marren → Lemmer 1188
steigerbouwhoorn.nlSteigerbouw HoornThe website of Steigerbouw Hoorn presents itself as a specialist in the construction, rental, and safety inspection of facade and roof scaffolding, with NEN 2670 certification, and focuses on customers in Hoorn and West-Friesland.Building & Materials → Scaffolding 328 scaffolding 519 plan 2566 inspection 4279 safety 5819 rental 7257 quote 12863 De Fryske Marren → Lemmer 1188
janarendhaitsma.nlJan Arend HaitsmaThe website of Jan Arend Haitsma is a furniture and interior design company specializing in custom-made solutions, including interior design, kitchen, bathroom, and cabinet construction, as well as yacht refurbishment.Maritime → Shipbuilding 568 Interior → Furniture 7454 teak 103 yacht 647 kitchen 6443 interior 8093 furniture 8751 De Fryske Marren → Lemmer 1188
merksetters.nlMerksettersMerksetters is a marketing agency helping businesses with website design and online marketing strategies.Web Design & Development → Digital Marketing 998 website design 108 online marketing 1085 marketing 7107 strategy 9379 brand 17737 De Fryske Marren → Lemmer 1188
opslag-follega.nlOpslag FollegaOpslag Follega is an storage company that rents storage space in Lemmer and Follega.Logistics → Storage 1170 storage unit 68 storage space 388 contract 2415 facility 2616 sustainability 18451 De Fryske Marren → Lemmer 1188
nijmanrijopleidingen.nlNijman RijopleidingenNijman Rijopleidingen is a driving school located in West-Friesland and surrounding areas, dedicated to training drivers to be safe and competent.Primary Education → Traffic Education 128 traffic safety 99 driving school 696 driver's license 1283 anxiety 1596 instructor 3126 De Fryske Marren → Lemmer 1188
vakantiehuis-friesland.nlVakantiehuis FrieslandThe website provides an online platform for booking and discovering luxury holiday homes in Friesland, with a focus on nature houses and unique accommodations.Vacations → Nature Vacations 269 nature house 45 friesland 692 holiday home 2753 vacation 4234 accommodation 4921 Tynaarlo → Paterswolde 168
vlaggenmaster.nlVlaggenmasterThe Vlaggenmaster is a company that sells and installs flagpoles, flags, banners, and accessories, with services geared towards both private individuals and businesses.Advertising Materials → Flags 103 Advertising → Banners 121 flagpole 57 mast 80 banner 518 flag 529 De Fryske Marren → Oudemirdum 73
vakantiewoningplus.nlVakantie woningen met een plusThe website offers holiday homes, with a focus on natural locations, and now also with contactless stay options.Accommodation → Bungalow Parks 931 Event & Party Venues → Hotel Restaurants 158 stay 702 tree 1879 holiday home 2753 nature 9094 Heumen → Nederasselt 56
huisman-makelaars.nlJasper HuismanThe website of Jasper Huisman is a real estate agency located in Balk, Gaasterland, and South West Friesland, specializing in helping clients buy and sell homes. It provides a database of properties and home videos and a service to find dream homes.Property Advice & Guidance → Property Transactions 184 Real Estate → Property Search & Listings 506 database 1153 agent 1253 brochure 1642 property 7406 house 8121 De Fryske Marren → Balk 224
dierenarts-kliniek.nldierenartsgids dierenartskliniek.nlThe website provides a directory of veterinary clinics in the Netherlands, including information such as reviews and opening hours.Planning → Travel Planning 716 reach 116 place 242 veterinarian 864 clinic 1079 reviews 3172 De Fryske Marren → Sint Nicolaasga 146
gewoon24.nlGewoon24Gewoon24 is a concept store in Sloten offering local products, handmade gifts, and home accessories.Crafts → Handmade 1147 Retail & Commerce → Concept Stores 45 creativity 2531 store 3901
hetgeschenkenhuis.nlHet GeschenkenhuisHet Geschenkenhuis is a shop in Balk that has been operating since 1915 and offers a diverse assortment of toys, household items, home decor and Friesland souvenirs.Local & Regional Focus → Local Businesses 1077 Food → Gifts & Souvenirs 2421 household items 61 souvenir 175 home decor 400 toy 2295 De Fryske Marren → Balk 224
saro-security.nlSaro-SecuritySaro-Security is a security company specializing in sustainable and environmentally friendly security services, offering a wide range of security solutions.Security & Surveillance → Security 3251 guards 29 work 3122 security 6655 sustainability 18451 De Fryske Marren → Lemmer 1188
daftocht.nlDAFtochtThe website of DAFtocht offers opportunities to rent DAF cars and Solex vehicles in Balk, Friesland, for individual trips and group activities.Cars → Rental Cars 58 Outdoor & Recreation → Group Activities 509 daf 51 solex 61 tour 2315 arrangement 3104 region 5412 Amsterdam → Sloten 146
appartementdepastorie.nlFam. PiersmaThe website presents a holiday apartment, "De Pastorie", in Molkwerum, Friesland, and provides information about the location and amenities.Accommodation → Bungalow Parks 931 holiday 2295 apartment 5088 garden 13129 Southwest-Friesland → Hindeloopen 127
lotusbewindvoering.nlLotus BewindvoeringThe website of Lotus Bewindvoering describes the services of a factor (administrator) who manages financial affairs for a diverse group of clients, primarily in the West-Friesland, Purmerend, Waterland and Zaanstreek regions.Loans & Credit → Debt Relief 741 Business & Entrepreneurship → Factoring 113 factor 77 finance 5341 region 5412 communication 10162 De Fryske Marren → Lemmer 1188
reproplusnwf.nlReproplus Noord-West FrieslandReproplus Noord-West Friesland is an independent KI (Artificial Insemination) organization focused on the reproduction of cattle in the northwest of Friesland and North Holland.Livestock → Cattle Farming 138 insemination 19 bull 47 fertility 289 De Fryske Marren → Lemmer 1188
actiefpedicurepraktijk.nlActief PedicurepraktijkThe website of Actief Pedicurepraktijk in Grootebroek offers pedicure services for both men and women, with a focus on caring for feet and treating various foot problems.Orthopedics → Foot Problems 977 foot 1929 pedicure 2196 complaint 6479 De Fryske Marren → Lemmer 1188
bert-renkema.nlSlotenmaker RenkemaThe website of Slotenmaker Renkema provides 24-hour locksmith and keyspecialist services in Friesland, focusing on quickly resolving situations of being locked out and offering various security solutions.Repair → Lock Repair 266 Bathrooms & Plumbing → Home Improvement 7367 keys 370 friesland 692 locksmith 919 locks 953 security 6655 house 8121 Southwest-Friesland → Bolsward 566
haarwerkenfriesland.nlteamharryhummelHaarwerken Friesland is a specialized salon in Friesland that offers hairpieces for people experiencing hair loss.Hair Care → Hair Extensions 282 Disease & Treatment → Conditions 174 hairpiece 153 hair loss 242 salon 5541 De Fryske Marren → Joure 689
derkstegeman.nlDerk StegemanThe website of Derk Stegeman is a professional presentation of a cellist, teacher, and conductor offering his services to string and symphony orchestras and for musical accompaniment, choir leadership, and cello lessons.String Instruments → Cello 76 Recordings & Media → Musicians 437 cello 121 conductor 1217 orchestra 1315 teacher 2890 Southwest-Friesland → Pingjum 43
reformerbysuus.nlREFORMER by SuusThe website for REFORMER by Suus is a Pilates studio located in West-Friesland specializing in lessons on the Reformer machine. The aim is to inform visitors about the lessons, book them, and highlight the benefits of Pilates on the Reformer.Fitness → Pilates 598 reformer 61 pilates 545 lesson 5154 studio 5465 package 6112 De Fryske Marren → Lemmer 1188
bouwbedrijfvandebeek.nlBouwbedrijf van de BeekBouwbedrijf van de Beek is a construction company focused on renovating or building homes, aiming to create a stylish and functional home for its clients.Construction Companies → Residential Construction 1013 Architecture & Design → Building Consulting 314 idea 2367 house 8121 renovation 13849 De Fryske Marren → Balk 224
glasserviceterpstra.nlGlasservice TerpstraGlasservice Terpstra is a glass company based in Bakhuizen (Friesland) that helps individuals and businesses with the installation of quality glass, glass repair, and advice on energy-saving measures and subsidies.Building & Materials → Glass 697 Energy → Energy Advice 279 window 2030 insulation 2448 subsidy 2649 glass 2919 safety 5819 energy 9075 Southwest-Friesland → Workum 363
mdj-atelier.nlMDJ AtelierThe MDJ Atelier website showcases the artwork of visual artist Marc de Jong, who lives in the countryside near Wapse and draws inspiration from nature and the stories of people.Galleries → Dutch Galleries 49 swallowing 129 gallery 1983 paintings 3907 artist 5745 nature 9094 De Fryske Marren → Echten 54
dagankertjes.nlFysiotherapie De MarrenThe website Dagankertjes offers training and support to individuals seeking recovery after a sudden change in their health or following a Parkinson’s disease diagnosis, utilizing the Dagankertjes Journal.Neurology → Parkinson’s Disease 98 Research & Academia → Academic Disciplines 93 journal 294 physiotherapy 4688 training 28133 De Fryske Marren → Balk 224
fotoclubdespil.nlFotoclub de SpilFotoclub de Spil is a photography club located in Sneek and surrounding areas, focused on sharing knowledge and experience in the field of photography.Neighborhood Organizations → Residents’ Associations 965 Arts → Imaging & Photography 7687 darkroom 16 neighborhood 2424 community 7931 photography 9503 member 10154 Southwest-Friesland → Sneek 1921
roosenpiet.nlZwemschool Roos en PietThe website of Zwemschool Roos en Piet provides information about the swimming school, the lessons offered, swimming opportunities, contact details, and opening hours.Swimming → Swimming Lessons 276 Education → Special Needs & Support 6372 swimming school 65 swimming lesson 393 swimming 850 Southwest-Friesland → Koudum 134
jdwassenaar.nlProtestantse gemeente HellendoornThis personal website of Dr. J.D.Th. Wassenaar, a preacher and publicist based in Hellendoorn, presents his publications, a CV, news, and information about his lectures on the 1825 flood, and his involvement in a documentary.History → Social Sciences 10786 Religion → Protestantism 3178 flood 84 preacher 150 documentary 1081 lecture 1624 publication 2018 Zwartewaterland → Zwartsluis 228
neefjesgroenvoorziening.nlNeefjes GroenvoorzieningNeefjes Groenvoorziening is a landscaping company specializing in ponds in West Friesland, offering services for the installation and maintenance of ponds.Garden Maintenance → Garden Landscaping 711 Nature Conservation → Water Management 1138 pond 686 garden 13129 De Fryske Marren → Lemmer 1188
sierensteen.nlSier & SteenThe website of Sier & Steen offers handmade gemstone jewelry and suncatchers, as well as workshops to introduce customers to creating these creations. The site also provides an overview of upcoming markets and events where Sier & Steen will be present.Jewelry → Handmade Jewelry 862 Markets → Art Markets 63 gemstone 856 market 2772 jewelry 4599 workshop 19325 Midden-Drenthe → Orvelte 54
nelblomdestolp.nlAtelier de Stolp Nel BlomThe website of Nel Blom is an online portfolio and presentation of her ceramic work, including information about her studio and exhibitions.Crafts → Ceramics 1156 raku 44 glaze 97 ceramics 1271 inspiration 4081 studio 5465 De Fryske Marren → Lemmer 1188
rijschoolbybart.nlRijschool by BartThe website of Rijschool by Bart is an online platform providing information and services for obtaining a driver's license in Medemblik and the surrounding area, specifically focused on the West Friesland region.Primary Education → Traffic Education 128 driving lesson 712 driver's license 1283 package 6112 car 10865 De Fryske Marren → Lemmer 1188
ijsclubberkhout.nlIJsclub BerkhoutIJsclub Berkhout is a club that organizes activities such as skating, sailing, and parties, primarily around the event Berkhout Beach.Winter Sports → Skating 841 Outdoor & Recreation → Location-Based Events 12 ice 178 coronavirus 191 ice rink 265 club 4225 event 45199 De Fryske Marren → Lemmer 1188
fokking.nlFokking Gaastweg 4The website is an online store offering clothing, including hoodies, shirts, polo shirts, and accessories, targeted towards women, men, and children.Men’s Clothing → Shirts 177 Clothing → Hoodies 62 polo shirt 82 hoodie 150 shirt 669 clothing 9443 accessories 12975 De Fryske Marren → Sint Nicolaasga 146
powertothemax.nlPower to the MAXThe website Power to the MAX offers personalized training and hydrogen therapy as methods to improve individuals’ health, energy, and athletic performance.Essential → Health 91589 personal training 1271 rehabilitation 1512 health 6366 De Fryske Marren → Lemmer 1188
aikidofriesland.nlAikido FrieslandThe Aikido Friesland website provides information about aikido training sessions held in Joure and Heerenveen, and offers the opportunity to attend a trial class.Body & Movement → Movement 967 Martial Art → Aikido 101 aikido 148 trial class 311 self-confidence 1173 body 3490 collaboration 16036 training 28133 De Fryske Marren → Joure 689
hovetechniek.nlHove TechniekHove Techniek is a company based in Zwaag, West-Friesland, specializing in installation technology and offering services such as maintenance and repair of boilers and air heaters.Climate Control → Cooling 585 Home Improvement → HVAC Systems 773 installation technology 223 boiler 1240 contract 2415 maintenance 20093 De Fryske Marren → Lemmer 1188
labfs.nlLabFSLabFS is a distributor of laboratory equipment and materials, specializing in brands like BROEN-LAB, Trespa® TopLab®, Keraplan, and Kyocera.Research → Laboratory Equipment 78 Maintenance & Repair → Industrial Maintenance 732 basins 12 laboratory 478 equipment 4143 maintenance 20093 De Fryske Marren → Lemmer 1188
wirevo.nlWirevo voegbedrijfWirevo voegbedrijf is a restoration company specializing in pointing, facade cleaning and renovation.Cleaning Services → Facade Cleaning 418 Masonry & Plastering → Masonry 576 point 217 facade cleaning 385 restoration 3417 Eemsdelta → Garrelsweer 14
delaatsteeer-sintnyk.nlBegrafenis- en Crematievereniging DE LAATSTE EERThe Laatste Eer is a funeral and cremation association that supports bereaved families and assists with arranging funerals.Social Issues → Social Organization 13315 Family → Funeral Services 2084 cost 1990 funeral 2477 board 3438 association 8562 member 10154 De Fryske Marren → Sint Nicolaasga 146
natuurprint.nlAlbert Foekema FotografieThe website, Natuurprint.nl, showcases the nature photography portfolio of Albert Foekema, featuring landscapes, macro photography, and details of nature.Nature & Landscape → Nature Photography 482 Nature & Landscape → Landscape Photography 530 macrophotography 51 butterfly 140 flora 171 bird 922 landscape 2609 nature 9094 Southwest-Friesland → Sneek 1921
klankbyld.nlKlankByldThe website KlankByld showcases the creative services of Christina van der Bijl, who combines music and visuals in video, photography, and audio editing, particularly focused on events and musical groups.Orchestras → Arrangements 23 Composition & Theory → Composition 402 conducting 47 visuals 207 video 6714 photography 9503 music 13170 De Fryske Marren → Lemmer 1188
lydiatenboom.nlLydia's HaarstylingLydia's Haarstyling is a hair salon located in Rotsterhaule that offers hair styling services, including coloring and permanent treatments. Clients can book appointments online or by phone.Hair Education → Hair Products 612 permanent 57 hairstyling 482 email 1012 phone 1163 color 4159 appointment 13510 De Fryske Marren →  Rotsterhaule 19
remcodijkstragoudsmederij.nlRemco Dijkstra GoldsmithThe website of Remco Dijkstra Goldsmith showcases a goldsmith in Emmeloord who designs and manufactures unique, handcrafted jewelry based on personal wishes and stories.Crafts → Goldsmithing 168 goldsmith 224 jewelry 4599 story 8285 workshop 19325 design 27202 Noordoostpolder → Emmeloord 1649
gezondheidscentrumlemsterpark.nlGezondheidscentrum LEMSTERPARKGezondheidscentrum LEMSTERPARK is a multidisciplinary healthcare center located in Lemmer, offering a range of health services under one roof.Primary Care → Health Centers 409 healthcare center 71 disciplines 134 healthcare provider 474 dentistry 606 sport massage 630 physiotherapy 4688 De Fryske Marren → Lemmer 1188
gastvrijlemmer.nlGastvrij LemmerThe website Gastvrij Lemmer provides a platform and coordinates an initiative to support refugees and asylum seekers in Lemmer and the surrounding area, focusing on practical assistance, social connections, and language training.Social Organization → Refugee Support 49 Social Issues → Humanitarian Aid 621 host family 43 loyalty card 87 volunteer 8367 course 14728 De Fryske Marren → Lemmer 1188
landelijkezitmeubelen.nlLandelijkeZitmeubelenLandelijkeZitmeubelen is a rural furniture store offering a wide selection of country-style furniture, accessories, and rugs.Living & Dining → Chairs 393 Living & Dining → Living Room Furniture 163 dining chair 40 armchair 201 rug 299 sofa 481 atmosphere 5591 furniture 8751 Southwest-Friesland → Workum 363
telefonielemmer.nlIT Friese MerenThe website offers reliable and cost-effective VoIP telephone services to businesses in Lemmer and the surrounding area.Telecommunications → VoIP 297 Technology → IT 3337 voip 425 telephony 494 cost 1990 package 6112 De Fryske Marren → Lemmer 1188
blesbouw.nlBlesbouwBlesbouw is a construction company based in Oudehaske, Friesland, offering new construction, renovation, and remodeling services.Building & Materials → Carpentry & Joinery 830 construction company 824 new construction 2672 renovation 13849 maintenance 20093 De Fryske Marren → Oudehaske 49
pp-equilibre.nlEquilibreEquilibre is a practice for adults offering various treatments for psychological complaints.Psychotherapy → Cognitive Behavioral Therapy 164 waiting time 140 psychologist 1196 registration 4366 complaint 6479 therapy 7448 practice 9089 De Fryske Marren → Bakhuizen 45
bleekerenbleeker.nlBleeker & BleekerBleeker & Bleeker | Jachtservice & Verhuur is a yachting harbor and rental company based in Woudsend, Friesland, offering yachts and berths in the Frisian lakes and the IJsselmeer.Boating → Marinas 825 yacht service 21 sailing area 28 winter storage 182 berth 341 yacht 647 harbor 691 Southwest-Friesland → Woudsend 117
maengevelbeheer.nlMaen GevelbeheerMaen Gevelbeheer is an organization specializing in facade management and maintenance.Maintenance & Services → Facade Maintenance 673 Project Management → Construction Management 1038 assessment 1205 facade 1490 inspection 4279 maintenance 20093 design 27202 De Fryske Marren → Joure 689
haskerveldverhuur.nlHaskerveld VerhuurThe website Haskerveld Verhuur offers rental of trailers and forklifts in Joure, with the option of on-site rental and with or without a driver.Logistics & Transportation → Rental Companies 414 Trailers & Towing → Trailers 650 forklift 447 trailer 1624 transport 6105 rental 7257 De Fryske Marren → Joure 689
kantine-doniahal.nlIwan's Catering & Kantine DoniahalThe website of Iwan’s Catering presents the catering services and the history of the Kantine Doniahal, which is closing down after 15 years. The site also provides information about hall rental for sporting events.Cafes → Grand Cafés 228 Venues → Halls 419 hall rental 124 catering 6456 De Fryske Marren → Sint Nicolaasga 146
transportena.nlTransportena.nlTransportena.nl is an international and national transportation company based in Sneek, Netherlands, specializing in charter transport services and currently collaborating with Hoekstra Transport.Context 161394 charter 76 truck 1412 transportation 2851 Southwest-Friesland → Sneek 1921
groobo.nlGroothandel Groobo B.V.The website of Groothandel Groobo B.V. is a wholesaler specializing in the supply of beer, soft drinks, wine, and frying oil to the hospitality industry, events, and bulk buyers, as well as private events. They also offer beverage rental and beer kegs.Sandwiches & Salads → Snacks 693 Coffee & Tea → Beverages 4453 soft drinks 87 beer 2887 hospitality 3491 event 45199 De Fryske Marren → Balk 224
relatie-gezinstherapiepraktijk.nlRelatie & Gezinstherapie Praktijk – Alke SlumpThe website of Relatie & Gezinstherapie Praktijk – Alke Slump presents her services in the area of psychosocial therapy, relationship and family therapy, and EMDR therapy, with the goal of supporting people in restoring relationships and promoting mental wellbeing.Relationships → Relationship Problems 643 Professional Development → Supervision 788 psychosocial therapy 39 system therapy 95 emdr 549 relationship 4205 therapy 7448 De Fryske Marren → Lemmer 1188
sparetiid.nlSpare TiidSpare Tiid is a restaurant located in Terherne specializing in ribs and other dishes, offering both dine-in and take-out options.Restaurants & Dining → Fine Dining & Gastronomy 2338 rib 191 sauce 1141 fries 2753 reservation 3373 menu 13856 De Fryske Marren → Terherne 98
bedrijfsunitsbalk.nlHostingpoint.nlThe website Bedrijfsunits huren Balk offers business units for rent and sale on the Eigen Haard business park in Balk.Commercial Property → Business Parks 324 Office Space → Rental Space 537 warehouse space 13 attic 112 business unit 129 business park 372 rental 7257 De Fryske Marren → Balk 224
rvs-eilers.nlEilers RVS bewerkingEilers RVS bewerking is a company with 33 years of experience in the stainless steel (RVS) industry, specializing in work involving sectors like dairy, confectionery, and serial machine construction.Industrial Equipment & Services → Machine Building 665 Metalworking → Stainless Steel Fabrication 161 rvs 119 machine construction 146 installation 13742 De Fryske Marren → Balk 224
bakkercncservice.nlBakker CNC Service & Machinehandel BVBakker CNC Service & Machinehandel provides repair, consultation, and maintenance services for CNC metal machining machines.Industrial Equipment & Services → Machine Building 665 Metalworking → Machines 307 cnc machines 55 logistics 3257 machine 3727 repair 14576 maintenance 20093 De Fryske Marren → Balk 224
livebait.nlR.J. Mous LivebaitThe website of R.J. Mous Livebait is an online store and wholesaler that sells live bait, fishing tackle, reptile supplies, and aquarium food to wholesalers, retailers, and individuals.Fishing → Bait 27 E-Commerce → Pet Supplies 1013 worm 44 bait 148 De Fryske Marren → Balk 224
nedlak.nlNEDLAKThe website of Nedlak showcases a furniture finishing specialist offering a wide range of finishes and special effects for both small and large projects.Manufacturing → Specialized Manufacturing 31 Finishing & Trades → Finishing 547 finish 747 craftsmanship 1858 environment 4873 furniture 8751 De Fryske Marren → Balk 224
haantjesmotus.nlHaantjes MotusHaantjes Motus is a center that offers customized movement activities, focused on improving the condition and well-being of its visitors.Body & Movement → Exercise 1005 Sports → Sport Facility 4867 breathing therapy 64 trainer 1966 sport 4228 De Fryske Marren → Harich 35
skutsjebier.nlSkûtsjebierThe website is an online shop selling traditionally brewed specialty beer from Friesland, specifically Skûtsjebier, and provides information about the brewing process and beers.Beverages → Beer 1095 skûtsjesilen 17 sales points 88 album 1495 beer 2887 assortment 7799 Leeuwarden → Grou 366
bn-legewalden.nlBN Lege WaldenThe website of Bedrijvennetwerk De Lege Wâlden provides information and facilitates a local network for entrepreneurs in the villages of Akmarijp, Terkaple and Goingarijp in the Lege Wâlden region. The goal is to create connections and collaboration between local businesses.Business Networks → Regional Networks 47 Local Communities → Villages 1005 meetings 1011 profile 1965 newsletter 6504 network 11123 De Fryske Marren → Terkaple 24
copyshopjoure.nlFoto NantkoCopyshop Joure is a print and photo service in Joure, Friesland, offering various printing and copying options, including passport photos, canvas prints, and large-format printing.Image Products → Photo Printing 54 Communication & Content → Copying 77 passport photo 227 canvas 694 print 5511 video 6714 photography 9503 De Fryske Marren → Joure 689
laffratechniek.nlLaffra TechniekThe Laffra Techniek website showcases installation services for electrical, gas, water, and heating & cooling systems, with a focus on residential and business projects in Friesland and Northern Netherlands.Home Improvement → HVAC Systems 773 Manufacturing & Industrial → Commercial Services 116 charging station 789 solar panels 4701 installation 13742 repair 14576 De Fryske Marren → Oudemirdum 73
platenbaas.nlPlatenbaasPlatenbaas rijplatenverhuur provides temporary hard surfaces in the form of mats and shoring for construction projects and events.Venues & Rentals → Event Rental 723 mat 249 rental 7257 construction 7421 event 45199 De Fryske Marren → Joure 689
mbw-winaam.nlStichting MBWThe website MBW describes a new multifunctional outdoor space designed to improve the livability and vitality in North West Friesland, particularly in Harlingen.New Construction → Neighborhood Development 933 Parks & Gardens → Public Space 48 outdoor space 246 recreation 799 connection 4007 De Fryske Marren → Lemmer 1188
arjankool.nlArjan KoolThe website of Arjan Kool presents his work as a landscape designer and spatial quality advisor, with a focus on green city-rural connections.Green Spaces → Green Maintenance 449 Planning & Development → Spatial Planning 889 site 422 infrastructure 1460 landscape 2609 connection 4007 municipality 6837 West-Maas en Waal → Appeltern 113
lootsmavloeren.nlLootsma VloerenVloerenbedrijf Lootsma Vloeren is a skilled company specializing in the laying of cement concrete floors.Flooring → Floor Installation 11 floor 4781 Southwest-Friesland → Heeg 227
groenjoure.nlGroen JoureThe website of Groen Joure describes the mission and projects of a local group of residents committed to a sustainable and green development of Joure and surrounding areas.Initiatives & Collaboration → Initiatives 459 Education & Youth → Local Organization 65 nature 9094 sustainability 18451 De Fryske Marren → Joure 689
voegbedrijf-hdejong.nlVoegbedrijf H. de JongThe website of Voegbedrijf H. de Jong offers services related to stonework, facade maintenance, renovation and new construction, targeting both individuals and businesses.Maintenance & Services → Facade Maintenance 673 Masonry & Plastering → Masonry 576 impregnation 187 facade 1490 quote 12863 renovation 13849 De Fryske Marren →  Sintjohannesga 24
ahploegstra-kraanverhuur.nlAH Ploegstra Tuinonderhoud-loonwerk-kraanverhuurAH Ploegstra Tuinonderhoud-loonwerk-kraanverhuur is a company offering services for garden construction, landscaping, and equipment rental.Land Development & Earthworks → Earthmoving 643 Civil & Infrastructure → Earthworks 370 equipment rental 15 garden construction 86 landscaping 1529 paving 1942 certification 3380 De Fryske Marren → Joure 689
bouwbedrijfvanzwol.nlBouwbedrijf van ZwolBouwbedrijf van Zwol is a construction company based in Rotsterhaule specializing in new construction, extensions, renovations, and maintenance of houses and farmhouses.Construction Companies → Residential Construction 1013 Building & Materials → Carpentry & Joinery 830 construction project 701 farmhouse 878 extension 1941 new construction 2672 house 8121 renovation 13849 Heerenveen → Mildam 22
garagebijker.nlGaragebedrijf BIJKERThe website of Garage Bijker in Rotsterhaule presents the company as a small, independent garage offering maintenance, repairs, diagnostics, air conditioning service, and vehicle inspection (APK).Tires → Tire Service 931 Repair → Garage 1779 air conditioning service 34 bovag 91 garage 1210 apk 1333 repair 14576 maintenance 20093 De Fryske Marren →  Rotsterhaule 19
mjhoekstra.nlKlus- en hoveniersbedrijf MJ HoekstraKlus- en hoveniersbedrijf MJ Hoekstra is a company that offers a variety of handyman and landscaping services.Garden Maintenance → Garden Improvement 33 fruit tree 106 handyman 836 plant 4509 garden 13129 renovation 13849 De Fryske Marren →  Rotsterhaule 19
noorderlichtstudios.nlNoorderlicht Studio'sNoorderlicht Studios is a studio located in Friesland that offers both recording facilities and a rehearsal space, with a focus on professional audio recordings and a comfortable working environment.Recordings & Production → Recording Studios 473 Civil & Infrastructure → Roads 252 piano 820 view 1045 record 1098 ventilation 1110 room 3411 studio 5465 Southwest-Friesland → Sneek 1921
opestreek.nlOp’e StreekKattenpension Op’e Streek provides a safe and caring accommodation for cats during vacations or periods when their owners are unavailable.Animal Welfare → Animal Housing 32 Tourism → Holidays 1086 diploma 795 cat 1578 board 3438 vacation 4234 nutrition 4935 De Fryske Marren →  Rotsterhaule 19
hartjehoogeveen.nlB&B Hartje HoogeveenThe B&B Hartje Hoogeveen website presents a bed & breakfast located on the edge of Hoogeveen in Drenthe, offering guests a comfortable and relaxing stay in a garden house with its own facilities and access to the local area and activities.Nature → National Parks 898 garden house 377 bike 1541 theater 2544 terrace 4847 Noordoostpolder → Emmeloord 1649
hoedthondentraining.nlHoedt HondentrainingThe website of Hoedt Hondentraining offers professional dog training and advice, focusing on positive training methods specifically for Molosser-type dogs.Dogs → Exercise 16 behavior therapy 125 dog 5483 training 28133 De Fryske Marren → Lemmer 1188
itsein.nlIt SeinThe website of It Sein in Sint Nicolaasga, Friesland, offers energetic healing services aimed at restoring balance, strength, and energy to visitors, particularly with issues in the body, mind, or emotions.Alternative Medicine → Energy Medicine 988 Adult & Continuing Learning → Spiritual Education 231 energetic healing 30 magnetizing 50 balance 4582 complaint 6479 energy 9075 De Fryske Marren → Sint Nicolaasga 146
dinakamsteegmakelaardij.nlDina Kamsteeg MakelaardijDina Kamsteeg Makelaardij is a real estate agency based in Medemblik specializing in the sale and purchase of properties in West-Friesland.Real Estate → Valuation Services 76 Context 161394 purchase 2212 valuation 2697 inspection 4279 sale 5930 property 7406 De Fryske Marren → Lemmer 1188
lindasvloerenengordijnen.nlLinda’s Vloeren en GordijnenThe website, VOOR MOOI WONEN Linda’s Vloeren en gordijnen, is an interior specialist offering flooring, window coverings, and related services in West-Friesland and the Wieringermeer.Interior → Window Coverings 1026 Decor & Furnishings → Home Goods Retail 26 window coverings 1213 interior design 1802 floor 4781 De Fryske Marren → Lemmer 1188
werkenbijcomfortis.nlCOMFORTIS Nautical Seating & SleepingThe website of COMFORTIS Nautical Seating & Sleeping is a job board and describes the company and its open positions, with a focus on the woodworking workshop, sewing workshop, and upholstery workshop.Furniture → Upholstery & Fabrics 1045 Maritime → Shipbuilding 568 woodworking workshop 10 sewing workshop 36 yacht 647 upholstery 673 vacancy 6598 interior 8093 De Fryske Marren → Lemmer 1188
notarispraktijken.nlNotarispraktijken.nlThe website aims to help users find a notary public in their area.Legal → Notaries 848 notary office 15 rating 217 notary 791 reviews 3172 region 5412 De Fryske Marren → Sint Nicolaasga 146
bouwhoorn80.nlBouwbedrijf Hoorn 80 BVBouwbedrijf Hoorn 80 is a construction company based in Hoorn, West-Friesland, offering services in the areas of damage repair, maintenance, remodeling, renovation, and restoration.Renovation → Extensions 651 Construction Companies → Additions 458 damage repair 326 remodeling 335 restoration 3417 construction 7421 renovation 13849 maintenance 20093 De Fryske Marren → Lemmer 1188
burgumheeftmeermagazine.nlMerksterkThe magazine 'Burgum has More' showcases the value of the town of Burgum and the surrounding region, highlighting entrepreneurs and tourist attractions.Context 161394 alderman 61 town 126 magazine 2182 region 5412 De Fryske Marren → Terkaple 24
brigittekraan.nlBrigitte KraanThis website is for the wedding officiant, Brigitte Kraan, focusing on personalized ceremonies and unique wedding locations.Weddings → Officiants 141 Religion → Marriage 212 officiant 126 ceremony 824 wedding 4258 De Fryske Marren → Broek 21
paradisesoul.nlParadise SoulParadise Soul Handpan studio Joure is a shop and studio that sells handpans and offers workshops and lessons.Instrument → Percussion 262 handpan 24 instrument 1295 lesson 5154 sale 5930 workshop 19325 De Fryske Marren → Joure 689
beautysalonmoniek.nlBeautysalon MoniekThe Beautysalon Moniek website presents services and products related to natural beauty care and holistic treatments.Hair Care → Salons 1476 Cosmetics & Skincare → Cosmetics 1122 agenda 4374 salon 5541 treatment 21203 De Fryske Marren → Joure 689
futureminded.nlFutureMindedThe FutureMinded website provides sustainability consulting and project management services to construction companies and clients in the construction and infrastructure sectors, aiming to help them achieve sustainability goals.Initiatives & Collaboration → Sustainability Knowledge 29 Consulting → Environmental Consulting 555 ambition 576 goal 4974 sustainability 18451 Delft → Tanthof-West 103
vakantiehuisjelemmer.nlVakantiehuisjes LemmerThe website offers a wide selection of holiday homes, with a focus on luxury villas and comfortable accommodations in various destinations.Holidays → Sun Holidays 67 Regions → Europe 6764 payment method 81 villa 1351 destination 2580 holiday home 2753 blog 13392 De Fryske Marren → Lemmer 1188
lemstertandhuis.nlLemster Tooth ClinicThe Lemster Tooth Clinic website showcases the services and team of a dental practice in Lemmer, offering the ability to make online appointments and find useful information.Dentistry → Implantology 304 dental practice 181 dental care 311 implant 613 child 11566 appointment 13510 Amsterdam → Sloten 146
pixelcentrale.nlpixelcentraleThe Pixelcentrale website offers 3D impressions and visuals for various sectors, including real estate, architecture, and the SMB sector. The focus is on creating appealing and convincing images.Architecture → Architectural Visualization 40 Architecture → 3D Visualization 79 impression 160 visualization 621 logo 4660 real estate 4981 De Fryske Marren → Joure 689
nacamateurclub.nlDutch Amateur Riders ClubThe website of the Dutch Amateur Riders Club provides news, standings, and information about events.Apparel → Equestrian 2319 equestrian 138 standings 143 facebook 850 news 15293 event 45199 Wassenaar → Duindigt 15
noordelijkkunstkader2020.nlNoordelijk Kunst Kader 2020The website of Noordelijk Kunst Kader 2020 showcases the activities of an artist collective that collectively exhibits artworks, bringing art to the public.Painting → Figurative Art 177 Galleries & Exhibitions → Exhibitions 1083 graphic art 89 ceramics 1271 jewelry 4599 exhibition 5332 paint 8747 Opsterland → Wijnjewoude 86
damwand-shop.nlProlock ShopThe Prolock Shop website is an online store and specialist in plastic dam walls, offering durable solutions for water management, infrastructure, and construction projects.Civil & Infrastructure → Hydraulic Engineering 85 Nature Conservation → Water Management 1138 dam wall 49 water management 260 durability 366 De Fryske Marren → Joure 689
hairextensions-schagen.nlMK HairextensionsThe website MK Hairextensions offers hair extensions and eyelash extensions, providing information and services related to hair extension and thickening. The company has salons in Schagen and Alkmaar.Hair Care → Hair Extensions 282 Beauty → Eyelash Services 1131 hair extension 384 eyelash extensions 415 permanent makeup 702 salon 5541 De Fryske Marren → Lemmer 1188
werkenbijholidayice.nlHoliday IceThe website of Holiday Ice presents job vacancies and company information, being a private label producer of ice, and offers contact details.Dishes → Soups 87 Food & Beverage → Food Industry 835 ice 178 retailer 373 production 4582 vacancy 6598 assortment 7799 De Fryske Marren → Sint Nicolaasga 146
manegeitbytling.nlManege it BytlingManege it Bytling is a riding club catering to riders with their own horses and ponies, offering lessons and riding facilities.Equestrian → Riding Clubs 245 Outdoor → Horse Riding 941 arena 124 stable 768 horse 4337 competition 4759 lesson 5154 course 14728 De Fryske Marren → Terherne 98
twavoorouderenkind.nlTWA for parent and childThe website TWA for parent and child provides support for parents and children aged -9 months to 18 years, focusing on parenting, growth, behavior, and learning.Pediatric & Child Health → Baby Care 220 Health → Pregnancy & Childbirth 4222 sling 20 parenting 972 pregnancy 2739 workshop 19325 Waadhoeke → Tzummarum 58
centrum-chai.nlCentrum ChaiCentrum Chai is a practice offering massage therapy, trauma therapy, and bodywork to treat stress and old patterns.Therapy → Alternative Therapies 865 Emergency & Safety → Alternative Healthcare 567 stress reduction 44 trauma therapy 45 body awareness 88 massage therapy 136 bodywork 319 coach 25810 De Fryske Marren → Delfstrahuizen 47
praktijkviamea.nlPraktijk ViaMeaPraktijk ViaMea offers therapy, coaching, and training services, specializing in grief processing, burnout, and trauma processing.Mental & Emotional Well-Being → Recovery 153 Mental & Emotional Well-Being → Trauma 1001 vitality 1726 trauma 2107 life 2673 balance 4582 therapy 7448 coach 25810 De Fryske Marren → Lemmer 1188
zuidwesthoekkeuring.nlTentoonstellingsvereniging 'De Zuidwesthoek'The website of ‘De Zuidwesthoek’ is a platform for the (young) cattle evaluation and preparation competition from Northern Netherlands, focused on evaluating and promoting young cattle.Livestock → Cattle Farming 138 Radio & Communication → Networks 341 calf 150 sponsor 1159 results 3954 competition 4759 news 15293 Heerenveen → Hoornsterzwaag 36
bootcamp-west-friesland.nlBootcamp West-FrieslandBootcamp West-Friesland offers outdoor bootcamp training sessions in various locations in West-Friesland.Fitness → Group Training 93 Outdoor & Recreation → Group Activities 509 group training 270 outdoor 381 bootcamp 497 challenge 1697 instructor 3126 community 7931 Drechterland → Venhuizen 154
thehealthychange.nlThe Healthy ChangeThe website of The Healthy Change presents a small-scale gym offering EMS training, kickboxing, and reformer pilates, with a focus on personalized guidance and results.Combat Sports → Kickboxing 448 Group Class → Fitness Centers 1010 reformer pilates 11 ems training 14 kickboxing 433 De Fryske Marren → Lemmer 1188
huitemabehangers.nlHuitema BehangersHuitema Behangers is a company specializing in wallpapering and decorative wall coverings, with a focus on quality and craftsmanship in the Heerenveen region.Construction Companies → Plasterers 843 Finishing & Trades → Finishing 547 renovlies 88 wallpaper 1756 paint 8747 De Fryske Marren → Tjerkgaast 16
haarstudiomarianne.nlHaarstudio MarianneThe website of Haarstudio Marianne showcases a special haircutting technique, ‘Global Curls’, for clients with curls and waves, and provides hair styling, coloring, and makeup services.Services → Hairdressers 1021 curl 55 hairstyle 812 color 4159 salon 5541 appointment 13510 De Fryske Marren → Lemmer 1188
bo-montage.nlBO MontageBO Montage is a contractor specializing in renovation and construction projects, including installing plastic frames, replacing wooden frames, applying concrete floors, and performing complete renovations and new builds.Maintenance & Repair → Sole Proprietorships 129 Sustainable Building → Construction Projects 823 roof cap 23 new build 120 concrete floor 184 extension 1941 frames 2556 renovation 13849 Ooststellingwerf → Appelscha 331
praktijkvanhuizen.nlPraktijk van HuizenThe website of Praktijk van Huizen is a physiotherapy practice located in Grou, Friesland, offering holistic therapies.Therapy → Breathing Therapy 194 Context 161394 cranio sacral therapy 25 breathing 976 sport 4228 physiotherapy 4688 De Fryske Marren → Joure 689
psychologenpraktijkzuidwest.nlPsychologenpraktijk ZuidWestPsychologenpraktijk ZuidWest is a practice offering psychological support to children, young adults, and adults with mild to moderate complaints in the Friesland region.Child Psychology → Problem Solving 141 Education → Pedagogy & Methods 2944 diagnosis 1490 complaint 6479 therapy 7448 treatment 21203 Southwest-Friesland → Hindeloopen 127
onsliefdesfeest.nlFrederika Postma and Lieke van AsOns Liefdesfeest is a website that organizes and supports love festivals, focusing on unique and personalized celebrations.Services → Personal Services 1062 Celebratory Occasions → Wedding Events 51 ceremony 824 connection 4007 inspiration 4081 De Fryske Marren → Joure 689
debakmakker.nlBakmakkerThe website of Bakmakker specializes in the repair, supply of parts, tuning, and diagnosis of American automatic transmissions and torque converters, primarily for classic and modern American vehicles.Auto Parts & Tires → Vehicle Parts 205 Automotive Maintenance → Chiptuning 229 automatic 94 transmission 124 tuning 419 drive 428 part 5044 repair 14576 De Fryske Marren → Oudehaske 49
herenvandegevel.nlHeren van de GevelHeren van de Gevel is a company specializing in the supply and installation of frames, with a focus on West Frisian craftsmanship and customer satisfaction.Windows → Frames 1211 Bathrooms & Plumbing → Home Improvement 7367 customer satisfaction 528 craftsmanship 1858 frames 2556 order 6912 installation 13742 De Fryske Marren → Lemmer 1188
wurkjouwer.nlWurkjouwerThe website of Wurkjouwer focuses on supporting individuals seeking to become more active and reintegrate into society through activities and training programs.Local Politics → Municipal Council 484 Social Services → Integration 438 wmo 340 integration 1451 municipality 6837 training 28133 De Fryske Marren → Haskerhorne 14
tennisschoolvanderlaan.nlTennisschool van der LaanThe Tennisschool van der Laan offers tennis lessons throughout the year at TV Joure, catering to both beginners and advanced players.Stables → Lessons 112 tennis 836 seniors 904 court 999 youth 3126 lesson 5154 De Fryske Marren → Joure 689
nupoort-schilderwerken.nlNupoort Schilder & OnderhoudswerkenThe website of Nupoort offers painting and maintenance services, including interior and exterior painting, wallpaper, and wallpaper fabrics, that the entrepreneur provides in the West Friesland region.Interior → Woodwork 86 Personal & Household → Household Services 1050 maintenance service 19 woodwork 387 wallpaper 1756 paint 8747 De Fryske Marren → Lemmer 1188
shootlocaties.nlShootlocaties.nlShootlocaties.nl is a platform that helps photographers, videographers, and other professionals in the Netherlands and Belgium find suitable locations for their projects, such as photoshoots, video recordings, workshops, and podcast recordings.Imaging & Photography → Family & Newborn 1285 Context 161394 photoshoot 1018 podcast 3328 studio 5465 book 11396 workshop 19325 De Fryske Marren → Lemmer 1188
modelballonteam.nlModelballon Team Midden NederlandThe website of Modelballon Team Midden Nederland presents information about model balloon demonstrations, events, and photos of their activities.Seasonal & Weather → Air Shows 10 Air Services → Aviation 444 pilot 208 demonstration 377 balloon 554 event 45199 Lingewaard → Gendt 190
weidsebliktuinendier.nlWeidse Blik Tuin & DierWeidse Blik Tuin & Dier is a shop in Joure that sells garden maintenance products and animal feed, and provides agricultural advice.E-Commerce → Pet Supplies 1013 Animals → Pets 1382 weighbridge 22 garden maintenance 462 feed 672 pet 1617 promotion 2062 horse 4337 De Fryske Marren → Joure 689
langebeekehoveniers.nlLangebeeke HoveniersThe website of Langebeeke Hoveniers presents a gardening company that offers services for garden design, landscaping, and maintenance in the vicinity of Emmeloord and Lemmer.Garden Maintenance → Garden Landscaping 711 Energy & Sustainability → Green Services 263 greenery 101 landscaping 1529 garden 13129 maintenance 20093 design 27202 De Fryske Marren → Lemmer 1188
lindashaarservice.nlLinda MolLinda's Haarservice is a mobile hair salon that provides hair services at the client's home in West Friesland.Hair Salons → Hair Care 2849 Essential → Home 70708 stylist 476 salon 5541 treatment 21203 De Fryske Marren → Lemmer 1188
lofderzotheidshop.nlLOF der Zotheid JoureThe website LOF der Zotheid Joure is an online store for fashion, home décor, and accessories that is temporarily closed but visitors can find information about the store, opening hours, brands and reviews from customers.Consumer → Gift Ideas 17 Context 161394 discounts 795 fashion 2212 reviews 3172 store 3901 brand 17737 De Fryske Marren → Joure 689
baasschilders.nlStephan Baas SchildersbedrijfStephan Baas Schildersbedrijf is a painting company specializing in painting, spraying, and renovation film, offering total maintenance services to private and business clients.Construction Companies → Plasterers 843 Interior → Wallpaper 1001 spray 658 painter 740 showroom 4883 paint 8747 maintenance 20093 De Fryske Marren → Lemmer 1188
schildersonlineshop.nlStephan Baas SchildersThe website of Schilders Online Shop, a part of Stephan Baas Schilders, offers advice, sales, and professional painting supplies to individuals and businesses in West Friesland, with a special focus on spray painting and wallpaper.Interior → Wallpaper 1001 Building & Materials → Paint 923 spray painting 175 interior advice 266 wallpaper 1756 showroom 4883 paint 8747 De Fryske Marren → Lemmer 1188
huisgelabeld.nlHuisgelabeldThe Huisgelabeld website offers services for obtaining, creating, and advising on energy labels for homes, in accordance with the NTA8800 method.Energy Saving → Energy Label 241 energy advice 165 energy label 744 home 7976 De Fryske Marren → Lemmer 1188
poortvanlemmer.nlPaiva ProjectontwikkelingThe website of Poort van Lemmer presents a new industrial area development in Leeuwarden, with a focus on sustainability and strategic location.Water Sports → Water Recreation 599 Construction & Building → Industrial Parks 52 plot 1051 industry 1780 sustainability 18451 De Fryske Marren → Lemmer 1188
adem-reis.nlAdemReisThe website offers breathwork, trauma release breathwork, and other techniques to promote inner well-being, emotional healing, and awareness.Mindfulness → Breathing Techniques 646 Mental & Emotional Well-Being → Psychotherapy 685 breathing session 35 inner 47 breathwork 318 awareness 1735 trauma 2107 De Fryske Marren → Joure 689
multispaces.nlMultispacesThe website of Multispaces presents a range of flexible, multifunctional business spaces and storage units, emphasizing high-quality and attractive spaces in the Joure region.Logistics → Storage 1170 storage unit 68 variant 68 business space 130 flexibility 996 De Fryske Marren → Joure 689
hawaii-muziek.nlOnbekendThe website offers services and products related to Hawaiian culture and entertainment, including dancers, musicians, decorations, and workshops.Parties → Themed Parties 583 Knowledge → Culture 82659 dancer 220 entertainment 1165 decoration 4085 party 5928 music 13170 workshop 19325 Bloemendaal → Aerdenhout 283
huladansen.nlHula DansThe website offers hula dancers, live music, workshops, and decorations for Hawaiian parties and events.Music & Performance → Party Nights 27 Arts & Culture → Dance 2687 live music 129 decoration 4085 party 5928 workshop 19325 Elburg → Doornspijk 142
groepsaccommodatiedesteven.nlDe Steven VakantiesGroepsaccommodatie De Steven offers a spacious holiday accommodation in Friesland, suitable for groups of up to 54 people.Water Activity → Water Sports 2944 Water Sports → Water Recreation 599 waterfront 44 lawn 427 watersport 540 bedroom 2051 accommodation 4921 kitchen 6443 De Fryske Marren → Langweer 93
nceb.nlNoordelijk Evenementen BureauThe Noordelijk Evenementen Bureau is an independent event agency in the northern Netherlands that focuses on organizing corporate and business events.Corporate Events → Corporate Outings 878 staff party 21 corporate event 224 conference 763 concept 3338 event 45199 Tytsjerksteradiel → Earnewâld 117
huisje-lemmer.nlHuisje LemmerHuisje Lemmer is a website offering holiday homes for rent in Lemmer, Friesland.Accommodation → Holiday Parks 1024 Accommodation → Bungalow Parks 931 friesland 692 park 1863 holiday home 2753 house 8121 De Fryske Marren → Lemmer 1188
keizersnedelittekennazorg.nlLiesbeth HilvertsThe website offers scar care and relaxing massages, specifically focused on women after a Cesarean section in North Holland.Medical Devices → Wound Care 62 Body & Movement → Physical Health 1058 scar 142 massage 7646 treatment 21203 Oldambt → Winschoten 830
hjabouw.nlHJ&A BouwThe purpose of HJ&A Bouw’s website is to offer construction advice and services, particularly carpentry and contracting work, to businesses and individuals in West-Friesland and North Holland.Renovation → Complete Renovation 40 carpenter 220 contractor 1039 construction 7421 quote 12863 De Fryske Marren → Lemmer 1188
dietistjolandawuite.nlDiëtistenpraktijk Jolanda WuiteThe website of Diëtistenpraktijk Jolanda Wuite presents the services of a certified dietician, Jolanda Wuite, who provides nutrition advice, diet advice and lifestyle advice, with a focus on a personalized and tailored approach.Nutrition → Dietetics 816 dietician 56 nutrition advice 240 treatment plan 380 De Fryske Marren → Sint Nicolaasga 146
hsehoekstra.nlHSE Support HoekstraHSE Support Hoekstra provides support to organizations to manage health risks and increase safety awareness.Occupational Medicine → Ergonomics 329 Training → Corporate Training 1331 workplace 1046 risk 2896 safety 5819 training 28133 De Fryske Marren → Lemmer 1188
groothandelsouvenir.nlSouvenirgroothandel Hollandse souvenirsThe website is a wholesaler specializing in souvenirs, offering a wide range of products including refrigerator magnets, posters, and Zeewse knots.Specialty Shops → Souvenirs 193 Gifts & Souvenirs → Gift Items 342 knot 37 magnet 127 souvenir 175 poster 837 item 1125 jewelry 4599 Veere → Oostkapelle 205
vishandel-antonoverweel.nlVishandel Anton OverweelThe website of Vishandel Anton Overweel presents an ambulant fish shop that delivers fresh fish and seafood platters in West-Friesland, with a focus on quality and customer service.Fish & Seafood → Fish 388 Supermarkets & Grocery → Fish Shops 191 fish 1121 party 5928 De Fryske Marren → Lemmer 1188
sanderpelt.nlSander Pelt HoveniersThe website of Sander Pelt Hoveniers presents the landscaping company and the services it offers, primarily focused on designing, installing, and maintaining custom gardens, mainly in the West Friesland region.Gardening → Garden Architecture 39 region 5412 garden 13129 maintenance 20093 design 27202 De Fryske Marren → Lemmer 1188
waterlandvastgoed.nlWaterland VastgoedWaterland Vastgoed provides services for the management and rental of real estate.Rental Properties → Renting 386 Real Estate → Real Estate Rental 70 tenant 920 space 3846 real estate 4981 portfolio 6854 rental 7257 De Fryske Marren → Joure 689
mitchelschipper.nlRijschool Mitchel SchipperRijschool Mitchel Schipper offers driving lessons in West-Friesland with a focus on a competitive price and personalized approach.Driver’s License → Theory 333 driving instructor 252 theory 956 license 1288 driving lessons 2453 practice 9089 De Fryske Marren → Lemmer 1188
slobsite.nlBouwkundig Tekenburo SlobThe website is a bureau offering architectural drafting and consulting services, primarily for private and business clients.Architecture → Architectural Services 1006 Architecture & Design → Building Consulting 314 architectural 20 drafting 308 drawings 1329 application 3377 consulting 3639 Buren → Maurik 162
stucadoorsproducten.nlStucadoorsproducten.nlStucadoorsproducten.nl is a wholesaler that supplies products for professionals in the construction and finishing trades, with a focus on stucco-related materials and tools.Plastering & Rendering → Finishing Materials 140 spackle 15 tape 305 plaster 2175 tool 3907 paint 8747 De Fryske Marren → Balk 224
westfresh.nlWestfreshThe website of Westfresh presents itself as the largest cauliflower supplier in the Netherlands, focusing on quality, continuity, and customer service.Organic Farming → Vegetable Cultivation 116 Produce & Vegetables → Vegetables 1070 cauliflower 10 grower 358 vegetables 1416 De Fryske Marren → Lemmer 1188
watervillaballingbuer.nlWatervilla BallingbuerWatervilla Ballingbuer is a website offering luxury holiday homes on navigable waters in the Netherlands.Accommodation → Villas 1018 Accommodation → Bungalow Parks 931 villa 1351 comfort 1473 water 2501 holiday home 2753 terrace 4847 Southwest-Friesland → Sneek 1921
commandeurschuiten.nlCommandeur SchuitenThe website of Commandeur Schuiten and Sloepen presents and sells new tuindersschuiten (garden boats) and offers services for the maintenance and restoration of boats and sloeps.Boats → Sloops 129 Water Sports → Water Recreation 599 storage 2446 boat 2980 restoration 3417 maintenance 20093 De Fryske Marren → Lemmer 1188
klaverweidevlees.nlKlaverweide VleesThe website of Klaverweide Vlees is an online platform and market stall selling organic meat from Friesland, including delivery service and offers.Supermarkets & Grocery → Butchers 747 Food → Meat 1123 butcher 148 delivery service 236 friesland 692 market 2772 De Fryske Marren → Joure 689
iepenloftjoure.nlIepenloft Fitness JoureIepenloft Fitness Joure is an outdoor fitness location in Joure offering a variety of training programs, including bootcamp, survival training, and group activities.Conferences & Meetings → Corporate Events 2472 Human Resources → Employee Benefits 245 vitamin 469 bootcamp 497 trainer 1966 training 28133 De Fryske Marren → Joure 689
reshapeclub.nlSportschool Reshape ClubThe website of Sportschool Reshape Club in Joure showcases the facilities, services, and promotions of the gym, aiming to encourage visitors to sign up or request a trial class.Sport Facility → Sports Centers 439 day pass 25 gym 699 personal training 1271 group classes 1306 equipment 4143 De Fryske Marren → Joure 689
administratiekantoordeglee.nlAdministratiekantoor De GleeAdministratiekantoor De Glee is an accounting firm that caters to sole traders, partnerships, and startups, offering various administrative and tax services.Accounting → Business Accounting 688 Finance → Taxation 1567 statement 83 return 909 tax 2100 account 5781 De Fryske Marren →  Sintjohannesga 24
boekmeester.nlBoekMeesterBoekMeester is a website offering financial planning, tax preparation, and business coaching services, primarily aimed at accounting firms, accounting offices, and entrepreneurs.Personal Finance → Financial Planning 1017 Business Services → Finance & Accounting 6613 business coaching 79 accounting firm 250 financial planning 439 nlp 487 De Fryske Marren → Sint Nicolaasga 146
vriendenvandeflecke.nlStichting Vrienden van De FleckeStichting Vrienden van De Flecke is an organization dedicated to improving the well-being of residents and clients of De Flecke care and treatment center in Joure.Charities → Fundraising 1005 friend 639 stay 702 center 1115 resident 3245 donation 5110 foundation 6678 De Fryske Marren → Joure 689
mariannemusic.nlMarianne MusicThe website of Marianne Music presents Marianne Groothof as a conductor, music teacher, and creative entrepreneur. The goal is to communicate her activities and services, including inspiring young people to make music, conducting orchestras, and creating portraits and live drawing events.Orchestras → Fanfare Orchestras 244 orchestra 1315 portrait 3685 studio 5465 music 13170 Heerenveen → Akkrum 246
beautybybelique.nlBeauty by BeliqueBeauty by Belique is a beauty salon in Lemmer that offers a wide range of cosmetic services and products.Eyelash Services → Eyebrows 777 Beauty → Nail Services 1048 eyelash 354 facial 424 eyebrows 1127 pedicure 2196 massage 7646 De Fryske Marren → Lemmer 1188
pukulanlemmer.nlPukulan BandungThe website of Pukulan Bandung presents the history, training, and philosophy of this Indonesian martial art.Asia → Indonesia 117 Martial Art → Indonesian Martial Arts 11 martial arts 216 instructor 3126 community 7931 training 28133 De Fryske Marren → Lemmer 1188
bergerpelletkorrels.nlBerger PelletkorrelsThe Berger Pelletkorrels website offers high-quality pellet pellets, certified for use in pellet stoves and fireplaces, and provides information on the pellets' characteristics and advice on combustion.Wood Products → Wood Pellets 54 Heating → Pellet Stoves 95 stove 305 heat 2188 certification 3380 wood 4153 De Fryske Marren → Oudehaske 49
bouwbedrijfagema.nlBouwbedrijf AgemaBouwbedrijf Agema is a construction company offering a range of construction projects and tasks, from small to large renovations and new builds.Construction Companies → Regional Construction Companies 152 Construction Companies → Additions 458 new build 120 construction company 824 task 1507 quote 12863 renovation 13849 De Fryske Marren → Haskerhorne 14
logopedietaalrijk.nlLogopedie TaalrijkLogopedie Taalrijk is a logopedie practice offering research, advice, and treatment for speech, language and related problems for children and adults.Childcare → Language Development 574 logopedie 121 speech 532 patient 4082 research 8967 treatment 21203 Noordoostpolder → Rutten 62
cineonefilms.nlCine One FilmsCine One Films is a creative film production company specializing in video production, film, animation, and artwork. They create high-end content for various projects.Architecture & Design → Creative Industries 1157 Technology → Post-Production 44 commercials 137 animation 1777 artwork 2248 production 4582 video 6714 De Fryske Marren → Lemmer 1188
dejong-bouw.nlStichting Survivalbaan EasterseeThe website provides information about De Jong Bouwbedrijf and the Survivalbaan Eastersee, including the opening of the Survivalbaan and Café de Jister.Garden → Swimming Pools 601 Outdoor Activity → Adventure Sports 15 stichting 481 café 944 sport 4228 De Fryske Marren → Oosterzee 29
gymverenigingbalk.nlGymnastiekvereniging de EvenwichtsbalkGymnastiekvereniging de Evenwichtsbalk is a sports club located in Balk that offers gymnastics lessons to members of all ages and skill levels.Sports Clubs → Gymnastics 481 freerunning 46 gymnastics 502 competition 4759 lesson 5154 member 10154 De Fryske Marren → Balk 224
bureau-haarsma.nlBureau HaarsmaBureau Haarsma and Architect W.G. Gielstra provide unique and intelligent design services, based on 30 years of experience and a focus on personal client relationships.Relationships → Partnerships 481 relationship 4205 collaboration 16036 design 27202 De Fryske Marren → Balk 224
almondegas.nlAlmondegasThe website of Almondegas presents a Brazilian samba band that performs at festivals, sporting events, and corporate events.Brazilian Music → Samba 31 Social & Events → Event Entertainment 92 samba 57 percussion 175 interaction 245 dance 1834 performance 7586 event 45199 De Fryske Marren → Lemmer 1188
mullerhorecaapparatuur.nlMüller Horeca ApparatuurMüller Horeca Apparatuur provides consultancy, products, and service for the design of restaurants and offices, aiming to optimize revenue.Dogs → Supplies 1005 Healthcare & Medical → Hospitality Technology 25 revenue 693 hospitality 3491 equipment 4143 De Fryske Marren → Balk 224
moaifeest.nlMoai Feest VerhuurMoai Feest Verhuur offers various bouncy castles, inflatable figures, and games for rent for different party occasions.Games → Outdoor Games 14 Event Rental → Bouncy Castles 161 inflatable figure 109 bouncy castle 366 party supplies 394 game 2807 De Fryske Marren →  Rotsterhaule 19
md-techniek.nlMD TechniekMD-Techniek is a small metalworking company specializing in the design and manufacturing of custom constructions and parts for various industries.Metalworking → Custom Fabrication 15 Mining & Materials → Metal Supply 46 prototype 603 construction 7421 design 27202 De Fryske Marren → Lemmer 1188
autogaragegids.nlAutogarage OverzichtThe website provides an overview of garages located in various regions of the Netherlands.Repair → Garage 1779 garage 1210 Sittard-Geleen → Munstergeleen 66
szijsling.nlSZ MetaalbewerkingThe website of SZ Metaalbewerking presents custom metalworking, shipbuilding, construction and assembly services, with a focus on repairs and renovations.Metalworking → Welding 893 Fabrication & Production → Fabrication 93 shipbuilding 148 metalworking 565 assembly 1733 construction 7421 renovation 13849 repair 14576 Southwest-Friesland → Heeg 227
ice-occasions.nlIce OccasionsIce Occasions is a company that sells used ice and shake machines, as well as coffee machines, and provides service to the hospitality and office sectors.Hospitality → Kitchen Equipment 315 Commercial Properties → Offices 773 ice machine 28 haccp 76 coffee machine 415 De Fryske Marren → Balk 224
onsboshuis.nlonsboshuis.nlThe website presents a holiday home called 'Het Boshuis' located in Gaasterland, Friesland, which is available for rent for families or couples.Vacations → Nature Vacations 269 forest 1418 cycle 1906 holiday home 2753 terrace 4847 family 6462 De Fryske Marren → Oudemirdum 73
sahypotheken.nlS&A Hypotheken & Financieel AdviesThe website S&A Hypotheken provides independent mortgage advice and brokerage services to individuals in Alkmaar, West-Friesland and surrounding areas, aiming to find the best mortgage with the lowest interest rate.Commercial Properties → Offices 773 Marketing & Advertising → Business Information 294 financial 855 advisor 1055 cost 1990 mortgage 4564 De Fryske Marren → Lemmer 1188
gjindrokte.nlGjin Drokte TentverhuurGjin Drokte is a party rental company that handles the full organization of events and parties.Event Rental → Attraction Rental 75 Event Rental → Tent Rental 437 tent 1328 party 5928 rental 7257 event 45199 De Fryske Marren → Balk 224
hougardy.nlHougardyHougardy is a handyman service that offers various renovation and handyman services in and around Hoorn, West Friesland and North Holland.Building & Materials → Carpentry & Joinery 830 cabinet 1730 job 2795 bathroom 3784 floor 4781 garden 13129 renovation 13849 De Fryske Marren → Lemmer 1188
kaizenryukaratedo.nlKaizen Ryu Karate DoKaizen Ryu Karate Do is a karate school that offers karate classes to people of all ages in Balk.Martial Art → Karate 246 karate 274 trial 398 growth 4054 lesson 5154 community 7931 De Fryske Marren → Balk 224
manegespiegels.nlFOSK MirrorsManegespiegels.nl provides custom mirrors for equestrian sports, both indoors and outdoors.Lighting → Chandeliers 32 Driving & Lessons → Vehicles 541 mirror 371 De Fryske Marren → Joure 689
notaris-overzicht.nlNotariskantoorThe website provides information on notarial services, including costs, locations, and various legal documents.Legal → Notaries 848 power of attorney 39 cohabitation agreement 44 bv 79 deed 129 transaction 613 notary 791 Het Hogeland → Leens 104
sbwonen.nlSB WonenThe SB Wonen website provides property valuations and purchase guidance in the West Friesland region, aiming to assist clients in finding and acquiring a property.Real Estate → Property Valuation & Appraisal 2123 Real Estate → Intangible Services 55 assessor 41 purchase 2212 valuation 2697 mediation 2787 property 7406 De Fryske Marren → Lemmer 1188
zorgboerenzuidwestfriesland.nlCoöperatie Zorgboeren Zuidwest FrieslandThe website of Zorgboeren Zuidwest Friesland presents a cooperative of care farms that offers a peaceful and stimulating environment for people with a need for care.Farms & Farm Businesses → Care Farms 473 green space 136 care farm 246 cooperation 433 work 3122 environment 4873 care 12338 Southwest-Friesland → Workum 363
administratielat.nlThe LATThe LAT is a employers' association that supports its members with payroll administration.Employment & Labor → Labor 504 Government & Administration → Government Organizations 1002 wage 22 payroll administration 979 employer 2383 member 10154 De Fryske Marren → Lemmer 1188
autorijlesbijgeerligs.nlAutorijschool GeerligsAutorijschool Geerligs is a driving school located in Rottum that offers driving lessons to students in the region.Transportation → Driving & Lessons 1163 driving school 696 driver's license 1283 exam 2120 driving lessons 2453 student 7623 Het Hogeland → Rottum 38
autorijopleiding-friesland.nlAutorijopleiding FrieslandAutorijopleiding Friesland provides driving lessons and training in Friesland to help people obtain a driver's license B.Driver’s License → Scooter License 102 license 1288 exam 2120 instructor 3126 lesson 5154 car 10865 course 14728 Southwest-Friesland → Workum 363
autorijschoolhhoogkamp.nlAutorijschool H. HoogkampAutorijschool H. Hoogkamp offers driving lessons in the Idskenhuizen region.Driver & Vehicle → Post-Secondary Education 40 Driving & Vehicle → Vehicle Operation 234 driving lesson 712 driver's license 1283 exam 2120 instructor 3126 region 5412 De Fryske Marren → Scharsterbrug 16
autorijschoolkw.nlAutorijschool KWThe website of Autorijschool KW is an online platform to offer driving lessons and theory courses in West-Friesland, with a focus on personalized guidance and a high pass rate.Driver’s License → Theory 333 theory 956 driver's license 1283 exam 2120 driving lessons 2453 instructor 3126 package 6112 De Fryske Marren → Lemmer 1188
bosadvocatuur.nlBos AdvocatuurBos Advocatuur Sneek is a law firm located in Sneek that provides legal assistance and specializes in various legal areas, with a focus on solution-oriented legal work and a personal approach.Legal → Lawyers 708 legal area 293 legal assistance 537 law firm 585 De Fryske Marren → Balk 224
c-clus.nlC-clusC-clus provides organizational advice to management, leaders, and teams, with a focus on quality improvement.Management → Quality Management 909 Health → Medical Care & Services 29461 organizational advice 80 coach 25810 De Fryske Marren → Sint Nicolaasga 146
ecofloornoord.nlECO FLOOR NOORD B.V.The website of ECO Floor Noord presents Eco 2 Floor, a self-leveling, cement-based leveling slab made of blast furnace slag, and provides information on its benefits, installation, and offer request.Sustainable Construction → Materials 1043 transport 6105 quote 12863 installation 13742 De Fryske Marren → Joure 689
ficor.nlFicorThe Ficor website offers solutions for the safe, sustainable, and low-maintenance renovation and new construction of balconies and galleries, with a focus on fiber-reinforced deck panels.Building & Materials → Steel & Metal 779 Olst-Wijhe → Wijhe 284
fotoboetje.nlFotoboetje.nlFotoboetje.nl is a specialist in photobooths and photo mirrors in West Friesland, providing affordable and stress-free solutions for various celebrations.Property Rentals → Rental 1169 Wedding → Photo Booths 146 props 122 strip 133 celebration 316 photobooth 359 De Fryske Marren → Lemmer 1188
hallolaadpaal.nlHallo TechniekHallo Techniek is a specialist in West-Friesland providing advanced energy solutions, including charging station installations.Living → Sustainable Living 817 Installation & Repair → Energy Installers 83 energy solutions 47 meter box 176 charging stations 421 home battery 517 craftsmanship 1858 sustainability 18451 De Fryske Marren → Lemmer 1188
hartvoorwestfriesland.nlHart for West-FrieslandThe website of Hart for West-Friesland provides information about the annual Open Class Sheepdog Trial in Spanbroek, including participant lists, results, news and a program.Running → Races 266 Animals → Dogs 5879 participant 1934 sponsors 2642 results 3954 news 15293 De Fryske Marren → Lemmer 1188
hekwerknoord.nlHekwerk Noord BVHekwerk Noord BV is a specialist in the design, manufacturing, and installation of custom fences and access gates.Garden → Fences 824 gate 499 steel 1177 fence 1814 installation 13742 Smallingerland → Drachten 2052
hoogeboomexclusive.nlHoogeboom ExclusiveThe website Hoogeboom Exclusive showcases a collection of exclusive automobiles, primarily from German brands such as Audi, BMW, and Volkswagen, emphasizing the emotional aspect of car ownership.Journalistic Visuals → Photojournalism 85 automobile 158 emotion 2169 collection 7566 brand 17737 De Fryske Marren → Joure 689
instituutnoord.nlInstituut NoordInstituut Noord – Typen is an educational institute offering individual and group typing courses, primarily for students in grades 6 to 8, and providing support for dyslexia.Driver & Vehicle → Continuing Education 454 computer course 14 type 310 dyslexia 408 course 14728 De Fryske Marren → Joure 689
klaver-snacks.nlKlaver SnacksKlaver Snacks is a catering and rental company that provides snack wagons, BBQ wagons, fish wagons, and other vehicles for events.Quick Bites → Food Trucks 623 snack wagon 24 toilet wagon 29 wagon 133 catering 6456 event 45199 De Fryske Marren → Joure 689
kuilema.nlMakelaardij KuilemaMakelaardij Kuilema’s website is a real estate agency based in Groningen specializing in the sale and purchase of properties, valuations, and assisting clients in finding their dream home.Property Agents & Brokers → Realtors 341 Real Estate → Agencies 243 dream home 59 property listings 88 brokerage 433 valuation 2697 property 7406 Oldambt → Heiligerlee 54
lesautometschade.nlDe Vos LesautoverhuurThe website offers rental cars with damage, providing a complimentary replacement rental car during the repair process.Rental Services → Car Rental 1047 rental car 178 form 679 damage 1562 warranty 4701 repair 14576 Dijk en Waard → Heerhugowaard 2011
lvgshowtechniek.nlLVG ShowtechniekLVG Showtechniek is a company specializing in the rental and sale of audiovisual equipment and providing technical support for various events.Event Resources → Event Technology 259 sound 1649 equipment 4143 light 5148 video 6714 event 45199 De Fryske Marren → Lemmer 1188
michelboontje.nlMichel BoontjeThis website showcases landscape photography by Michel Boontje, alongside other subjects, with a particular emphasis on coastal areas and locations in the Netherlands.Nature & Landscape → Landscape Photography 530 Landscape → Coast 155 coast 199 landscape 2609 animal 2908 photography 9503 Noordoostpolder → Marknesse 175
pianofriesland.nlJan van LiereThe website of Jan van Liere offers piano lessons and accompaniment services in Joure and surrounding areas.Guitar → Lessons 165 Music Education → Guitar Lessons 403 accompaniment 18 sheet music 269 piano lessons 346 rate 2606 choir 3123 De Fryske Marren → Joure 689
proceed-financieel.nlProceed FinancieelProceed Financieel is a financial service provider based in Lemmer, focused on providing tailored advice and support to clients.Legal & Administration → Business Support 488 Business Services → Finance & Accounting 6613 annual account 399 financial 855 advisor 1055 tax 2100 administration 6587 De Fryske Marren → Lemmer 1188
ridderbridge.nlBridgeclub ‘De Ridders van Sint-Joris’The website of the Bridgeclub ‘De Ridders van Sint-Joris’ provides information about the club, its activities, and contact details.Card Games → Bridge 186 Clubs → Bridge Clubs 39 bridge 557 match 3471 club 4225 partner 4272 association 8562 De Fryske Marren → Lemmer 1188
robmannaert.nlRob Mannaert TimmerbedrijfThe website of Rob Mannaert Timmerbedrijf showcases the services of a carpenter and contractor operating in the West Friesland region, specifically in Medemblik and surrounding areas, and provides a portfolio of previously completed projects.Wood & Timber → Timberwork 1596 Building & Materials → Carpentry & Joinery 830 carpenter 220 contractor 1039 task 1507 renovation 13849 maintenance 20093 De Fryske Marren → Lemmer 1188
slotenspecialistfriesland.nlBert RenkemaThe website of Slotenmaker Friesland provides emergency locksmith services and lock repair throughout Friesland, emphasizing reliability, experienced service, and 24/7 availability.Repair → Door Repair 19 Safety & Security → Key Makers 96 key 228 lock 368 friesland 692 locksmith 919 door 2210 security 6655 Southwest-Friesland → Bolsward 566
steneker-jachtbetimmeringen.nlSteneker JachtbetimmeringenSteneker Jachtbetimmeringen is a one-man business specializing in the construction of sloeps and the application of teak decks, with a particular focus on the Zuiderkruissloep.Maritime → Shipbuilding 568 Maintenance & Repair → Sole Proprietorships 129 teakdeck 17 sloep 127 shipbuilding 148 deck 268 craft 538 building 3204 De Fryske Marren → Sint Nicolaasga 146
vakantiehuisje-friesland.nlVakantiehuisje FrieslandThe website offers holiday homes and holiday parks in Friesland.Accommodation → Holiday Parks 1024 Accommodation → Bungalow Parks 931 holiday park 566 bungalow 687 deal 773 chalet 1264 holiday home 2753 accommodation 4921 Ooststellingwerf → Appelscha 331
visservandewateringen.nlVisser Van de Wateringen AdvocatenThe Visser Van de Wateringen law firm provides legal services in the Hoorn and Enkhuizen region, specializing in family law, administrative law and employment law.Law → General Law 324 Law → Family Law 1413 administrative law 194 family law 324 legal assistance 537 employment law 614 lawyer 2683 De Fryske Marren → Lemmer 1188
winbo.nlWinbo Insulation Concrete FloorsThe website of Winbo Insulation Concrete Floors provides information about the supply and application of foam concrete for floor insulation, specifically focusing on crawl space insulation, underfloor heating, and leveling floors.Heating → Underfloor Heating 343 Insulation → Floor Insulation 88 foam concrete 34 floor insulation 104 underfloor heating 757 De Fryske Marren → Joure 689
ydel-design.nlYdel DesignThe website of Ydel Design showcases a freelance graphic designer who helps businesses with branding and design, focusing on clarity, innovation, and custom solutions.Graphic Design → Freelance Graphic Designers 429 rebranding 33 branding 4614 portfolio 6854 design 27202 De Fryske Marren → Joure 689
zorgboerderijveldzicht.nlZorgboerderij Veldzicht B.V.Zorgboerderij Veldzicht offers day care, residential care, daycare and educational support for adults, children with developmental problems, and seniors with dementia or other issues.Neurology → Dementia 509 Special Needs & Support → Support 2006 educational support 26 residential care 79 dementia 674 daycare 1365 nature 9094 Heerenveen → Katlijk 43
1001uitjesophetwater.nl1001 uitjes op het waterThe website provides inspiration and information about watersports and recreational activities on the water, aimed at organizing outings for various groups.Water Sports → Water Recreation 599 Activities → Group Outings 133 watersport 540 outing 982 holiday 2295 blog 13392
aardwarmtetechniek.nlAardwarmte Techniek NederlandAardwarmte Techniek Nederland is a specialist in geothermal drilling and the design and implementation of geothermal systems.Renewable Energy → Geothermal Energy 73 permit 744 cost 1990 heat pump 2541 Midden-Delfland → Maashorst 275
abaandachtenbetrokkenheiduitvaartzorg.nlAB UitvaartzorgThe website of AB Uitvaartzorg provides professional funeral care with attention to the personal wishes of bereaved families, and serves an area in the provinces of Overijssel, Friesland, and Drenthe.Family → Funeral Services 2084 funeral 2477 wishes 2717 care 12338 De Fryske Marren → Balk 224
afravlaar.nlAfra VlaarThe website of Afra Vlaar offers body-oriented psychotherapy and trauma therapy in West-Friesland and North Holland, focused on promoting freedom and processing emotional issues.Therapy → Body-Oriented Therapy 437 trauma therapy 45 introductory consultation 45 body-oriented therapy 101 bodywork 319 conversation 1828 wellbeing 2620 De Fryske Marren → Lemmer 1188
akirasushi.nlAkira SushiAkira Sushi is a sushi restaurant in Lemmer that offers online ordering for delivery or pickup.Japanese → Sushi 971 pickup 736 sushi 1695 order 6912 restaurant 11215 menu 13856 De Fryske Marren → Lemmer 1188
akirasushi-lemmer.nlAkira Sushi LemmerThe Akira Sushi Lemmer website allows customers to order sushi and other Japanese dishes online in Lemmer. It also features a menu and customer reviews.Japanese → Sushi 971 nigiri 146 poke bowl 308 roll 358 sushi 1695 menu 13856 De Fryske Marren → Lemmer 1188
alecspoor.nlAlec Brendan SpoorThis website is a portfolio of Alec Brendan Spoor, a designer and photographer based in Joure, Friesland, showcasing his work.Technical Aspects → Tutorials 32 photoshop 88 camera 1733 portfolio 6854 photography 9503 design 27202 De Fryske Marren → Joure 689
allroundbedrijfcr.nlAllroundbedrijf CenRAllroundbedrijf CenR is a professional installation company specializing in bathroom and toilet renovations, plumbing, and CV (central heating) installations, primarily in West-friesland. The website offers a range of services including renovation, repair and installation, catering to both private and business clients.Plumbing → Drain Cleaning 745 Installation & Repair → Sanitation 289 toilet 467 cv 516 plumbing 1761 bathroom 3784 installation 13742 renovation 13849 De Fryske Marren → Lemmer 1188
alphonsebakker.nlGlashandel Alphonse BakkerThe website of Glashandel Alphonse Bakker showcases the services of a glass merchant with a long tradition in Heerenveen, specializing in triple glazing and other glasswork, with a focus on quality, sustainability, and customer satisfaction.Insulation → Double Glazing 23 glasswork 160 glazing 482 glass 2919 quote 12863 sustainability 18451 De Fryske Marren →  Sintjohannesga 24
amennis.nlAmennis TradingAmennis Trading is an online store selling a variety of wooden furniture, decorations, Christmas items, and souvenirs.Commerce → Greeting Cards 430 teak 103 christmas 320 greeting card 335 decoration 4085 furniture 8751 De Fryske Marren → Sint Nicolaasga 146
amooiweer.nlA. Mooiweer KraanverhuurThe website of A. Mooiweer Kraanverhuur presents the services of the company, specializing in crane rental, groundwork and streetwork, with a focus on road construction projects and paving works. The goal is to inform potential customers and request an offer.Construction Machinery → Crane Rental 135 Construction Machinery → Construction Equipment Rental 18 crane rental 68 streetwork 112 drainage 1322 groundwork 1348 paving 1942 Steenwijkerland → Scheerwolde 25
antoinetvisser.nlAntoinet VisserThe website of Antoinet Visser presents her practice for shiatsu, massage, and other therapeutic treatments, and provides information about her services and contact details.Alternative Medicine → Shiatsu 830 chakra 278 shiatsu 578 foot reflexology 597 reiki 1284 therapy 7448 massage 7646 De Fryske Marren → Lemmer 1188
aquaronde.nlAquarondeThe website of Aquaronde provides information and services for members and guests of the bungalow park and the Owners Association (VVE).Homeownership & Management → Homeowners Associations 546 Accommodation → Bungalow Parks 931 bungalow park 81 minutes 169 vve 748 forum 1362 member 10154 De Fryske Marren → Lemmer 1188
asfaltschoenen.nlVellinga Veiligheidsschoenen B.V.The website of Asphalt Profi, a part of Schütze Schuhe, offers a selection of specialized asphalt shoes designed for prolonged work on hot asphalt, aiming to protect workers’ feet.Office & Workspace → Business Directories 421 general terms and conditions 35 contact details 108 wishlist 135 De Fryske Marren → Nijemirdum 19
astridhoff.nlAstrid HoffThe website of Astrid Hoff Oefentherapie & Coaching presents the services of a physiotherapist and coach who guide people in recovering from physical ailments and improving their posture and movement habits.Essential → Health 91589 posture 548 change 2580 body 3490 physiotherapy 4688 complaint 6479 coach 25810 De Fryske Marren → Lemmer 1188
atelierhwh.nlAtelier HWHThe Atelier HWH website initially offered embroidery and textile work services but is now closed as of February 15, 2025. The website provides information about services transferred to other companies and a call for someone to continue the repair and embellishment of clothing and curtains.Crafts → Embroidery 624 embroidery 614 curtains 1015 textile 1421 logo 4660 clothing 9443 repair 14576 De Fryske Marren → Oosterzee 29
autocrossbantega.nlAutocrossClub BantegaThe website of AutocrossClub Bantega provides information about the annual autocross competition held annually in Bantega.Motorsport → Autocross 61 Sports & Auto → Agricultural Events 118 autocross 40 class 2076 results 3954 registration 4366 De Fryske Marren → Bantega 19
automotiveservicefryslan.nlAutomotive Service FryslânThe Automotive Service Fryslân website is an automotive repair and maintenance business located in Joure, Friesland, offering various services including vehicle inspections (APK), maintenance, air conditioning service, and tire service.Tires → Tire Service 931 Automotive Maintenance → Vehicle Inspection 1102 rental car 178 tire service 180 apk 1333 air conditioning 2178 maintenance 20093 De Fryske Marren → Joure 689
autopoetsenjoure.nlAutopoetsen JoureAutopoetsen Joure is an auto detailing business located in Friesland, offering car polishing and restoration services.Car Care & Detailing → Detailing 941 Maintenance & Services → Car Wash 495 exterior 237 cleaning 4567 interior 8093 car 10865 treatment 21203 De Fryske Marren → Joure 689
autorijschoolbeeksma.nlAutorijschool BeeksmaThe website of Autorijschool Beeksma offers driving lessons in Joure and the surrounding area, with the goal of teaching students to drive relaxed and confidently.Driving & Vehicle → Vehicle Training 553 driving instructor 252 driver’s license 438 driving school 696 driving lessons 2453 environment 4873 student 7623 De Fryske Marren → Joure 689
autorijschoolfolkert.nlAutorijschool FolkertAutorijschool Folkert provides driving lessons in Joure and the surrounding area, offering personalized guidance towards obtaining a driver's license.Driver & Vehicle → Driver’s License 1625 audi 103 driver's license 1283 exam 2120 driving lessons 2453 instructor 3126 package 6112 De Fryske Marren → Sint Nicolaasga 146
autorijschoolmarcovantol.nlAutorijschool Marco van TolThe website of Autorijschool Marco van Tol offers driving lessons, with a special focus on driving lessons for people with autism, ADHD, and exam anxiety, in the Hoorn and surroundings area.Education → Pedagogy & Methods 2944 Education → Special Needs & Support 6372 navigation 330 mirror 371 autism 758 confidence 1163 driving lessons 2453 car 10865 De Fryske Marren → Lemmer 1188
b3a.nlB3A – Boermans Bouwmanagement Beheer & AdviesThe website of B3A is a construction management and consulting firm offering services to private and commercial clients, specializing in new construction, renovations, maintenance, restoration, and remodeling.Legal → Construction Law 150 Project Management → Construction Management 1038 damage assessment 28 construction management 199 new construction 2672 consulting 3639 construction 7421 renovation 13849 De Fryske Marren → Joure 689
bakkeromdehoek.nlBakker om de HoekThe website Bakker om de Hoek provides addresses of bakeries, particularly in holiday destinations, including campsites.Bakery & Food Production → Bread 765 Dairy & Cheese → Dairy 763 baker 90 bread 1622 campsite 2093 vacation 4234 Schagen → Tuitjenhorn 382
balanceandenergy.nlBalance and EnergyThe website of Balance and Energy presents the services of a massage practice focused on relaxation, health, and energy, with information on treatments, opening hours, rates, and contact details.Essential 241016 relaxation 3968 health 6366 therapy 7448 massage 7646 energy 9075 practice 9089 Drechterland → Oosterwijzend 177
bandofbluesbrothers.nlThe Band of Blues Brothers & SistersThe website provides information about the final concert of The Band of Blues Brothers & Sisters in Sint Nicolaasga on December 13th and 14th, 2024, and supports two charitable organizations.Music & Performance → Music Events 758 Context → Community 57410 concert series 15 charity 700 band 2977 music 13170 event 45199 De Fryske Marren → Sint Nicolaasga 146
bbderodebaron.nlB&B de Rode BaronThe website of B&B de Rode Baron presents a characteristic Friesian stelpboerderij near Lemmer, Friesland, and provides information about the surrounding area, including the Woudagemaal and various picturesque villages in the region.Boating → Marinas 825 Local Life → Attractions 17 lake 352 cycling route 451 friesland 692 b&b 1060 De Fryske Marren → Lemmer 1188
bdjmontage.nlBDJ MontageBDJ Montage is a company that sells, installs, and repairs garage doors, overhead doors, and other types of doors, and also offers showrooms.Doors → Garage Doors 248 overhead door 107 garage door 365 door 2210 showroom 4883 assortment 7799 repair 14576 De Fryske Marren → Lemmer 1188
bdsmadvertenties.nlBDSMadvertentiesThe website BDSMadvertenties is a platform where individuals, including MariaAnnaHitsig, Mam, Vind Mij Pak mij, She-Maris, and Hertah, create profiles with personal descriptions and desires, likely aimed at finding partners.Social Media → Dating 1644 Internet → Forums & Communities 1599 post 140 profile 1965 wishes 2717 connection 4007 member 10154 Opsterland → Gorredijk 398
bedrijfspand-lemmer.nlDFMThe website offers for rent and sale commercial spaces and housing in Lemmer and the surrounding area, with a focus on sustainability and logistics.Temporary & Specialized Property → Business Housing 16 Commercial Property → Commercial Space 489 distribution center 77 commercial space 245 space 3846 housing 4378 sustainability 18451 De Fryske Marren → Lemmer 1188
bedrijfsuitjelemmer.nlBedrijfsuitje LemmerBedrijfsuitje Lemmer offers a variety of corporate and staff outings in and around Lemmer, with over 15 years of experience and a quality badge.Social Organization → Senior Organizations 750 Family Activities → Outings 763 staff outing 17 outing 982 city 1875 arrangement 3104 event 45199 Northeast-Friesland → Dokkum 846
bekabeplating.nlBEKA BeplatingBEKA Beplating is a company specializing in the installation of roofing and facade cladding, roofing and facade renovations, and shell construction (cascobouw), particularly for agricultural and commercial building projects.Renovation & Restoration → Building Techniques 63 Business Services → Business Activities 230 cladding 115 asbestos 387 renovation 13849 De Fryske Marren → Lemmer 1188
bij-annemieke.nlBij AnnemiekeThe website of Bij Annemieke offers coaching and workshop services, focused on personal growth, finding balance, and breaking negative patterns, particularly in the context of burnout and imbalance.Personal Development → Life Goals 32 Education → Sports Psychology 183 journey 701 passion 792 pattern 2012 growth 4054 balance 4582 coach 25810
bijl-bakker.nlBIJL | BAKKERThe website of BIJL | BAKKER presents the company's services in the field of transport, with a focus on national and international transport, including the transport of special loads and hazardous materials.Logistics → Warehouse Operations 739 Road Services → Road Transport 400 adr 99 load 136 distribution 1011 transportation 2851 vehicle 3743 De Fryske Marren → Langweer 93
bliidfotografie.nlBliid FotografieBliid Fotografie Oudehaske is a photography studio offering a variety of photographic services, including business portraits, artistic nudes, and sessions for women with breast cancer.Arts → Imaging & Photography 7687 session 1791 portrait 3685 photography 9503 workshop 19325 De Fryske Marren → Oudehaske 49
bloembollenmachines.nlHB Veilen B.V.The website HB Veilen B.V. is an online platform that facilitates the trade of second-hand machinery and materials in the agricultural sector by connecting supply and demand.Commerce → Auctions 157 E-Commerce → Marketplaces 1053 machinery 519 auction 561 supply 961 advertisement 1707 Noordoostpolder → Emmeloord 1649
bloemistservice.nlBloemenbezorging.nlThe website offers a service to deliver flowers, bouquets, and flower arrangements in the Netherlands.Delivery → Flower Delivery 210 Gifts & Occasions → Flower Shops 776 florist 57 roses 214 bouquet 1147 flowers 3248 shop 6483 Vijfheerenlanden → Ameide 97
blok8.nlBlok8 bvBlok8 bv is an independent developer focused on creating sustainable living and working environments by collaborating with future residents and investors.Building & Construction → Green Building 26 Planning & Development → Spatial Planning 889 ambition 576 house 8121 collaboration 16036 design 27202 Wijk bij Duurstede → Langbroek 118
bnbtinasneek.nlB&B TinaB&B Tina is a luxury bed & breakfast in Sneek, Friesland, offering guests a comfortable stay with amenities like free WiFi and a continental breakfast.Hotels → Boutique Hotels 914 Vacations → City Breaks 536 b&b 1060 wifi 1372 breakfast 1822 terrace 4847 kitchen 6443 Southwest-Friesland → Sneek 1921
boei-en-de-boot.nlBoei&deBootThe website showcases a houseboat named Boei&deBoot available for holiday rentals, highlighting its location in Stavoren and offering information about its features and history.Camping → Camper Rental 359 Accommodation → Houseboats 17 houseboat 130 holiday 2295 terrace 4847 history 7286 garden 13129 De Fryske Marren → Lemmer 1188
boekenwinkel-gids.nlBookshop GuideThe website Bookshop Guide provides an overview of bookstores in various provinces of the Netherlands.Directories → Websites 3473 Context 161394 town 126 bookstore 149 directory 176 province 518 Zwartewaterland → Genemuiden 405
boerderij-info.nlBoerderij-Info B.V.The website boerderij-info.nl is a platform that allows users to search for, discover, and review farms in the Netherlands. It offers services for farms to present their business and sell their products, as well as articles about farms.Business Development → Business Marketing 614 Agriculture → Farms & Farm Businesses 1115 farm 2622 article 6000 Haarlemmermeer → Hoofddorp 2739
boothandel.nlBoothandelThe website provides a directory of boat dealers and watersport shops in the Netherlands.Property Finance → Purchase 493 postcode 221 watersport 540 dealer 757 boat 2980 shop 6483 Hoorn → Zwaag 494
booytuinen.nlBooy TuinenBooy Tuinen is a gardening company located in Sint Nicolaasga that offers a range of gardening services, including design, landscaping, and maintenance.Garden Maintenance → Gardeners 685 garden 13129 maintenance 20093 design 27202 De Fryske Marren → Sint Nicolaasga 146
bosmagroenevakzaak.nlBosma Groene VakzaakThe website Bosma Groene Vakzaak is an online shop that sells gardening supplies and animal supplies, both online and with home or in-store delivery.Garden → Garden Wood 67 Outdoor & Garden → Garden Shops 795 lawnmower 144 calf 150 fence 1814 flowers 3248 plant 4509 De Fryske Marren → Sint Nicolaasga 146
bouwbedrijfdolstra.nlBouwbedrijf DolstraBouwbedrijf Dolstra is a construction company specializing in new construction, renovation, and remodeling projects.Building & Materials → Carpentry & Joinery 830 Sustainable Building → Construction Projects 823 construction project 701 new construction 2672 wishes 2717 renovation 13849 Weststellingwerf → Blesdijke 26
bouwbedrijfvanderzee.nlBouwbedrijf Van der ZeeThe website of Bouwbedrijf Van der Zee presents the company as a versatile construction firm with a long tradition, specializing in new construction, renovation, maintenance and specialized carpentry work, and offers job vacancies for carpenters.Economy → Employment & Labor 6059 carpentry 2218 new construction 2672 job 2795 construction 7421 renovation 13849 De Fryske Marren → Rijs 32
bouwservicevandermeer.nlBouwservice van der MeerBouwservice van der Meer is a timber company offering services for carpentry, renovations, and constructions in Friesland.Construction Companies → Timber Companies 178 Installation & Repair → Tradespeople 409 carpentry 2218 construction 7421 quote 12863 renovation 13849 maintenance 20093 De Fryske Marren → Joure 689
boxingdays.nlStichting Joure ActiefThe Winter Events Joure Swingt website provides information and photos about various winter events and Boxing Days held in Joure, Netherlands.Running → Running Events 684 Seasonal & Weather → Winter Events 131 photo 7778 event 45199 De Fryske Marren → Joure 689
brassinc.nlBrass Inc.Brass Inc. is a cover band based in Joure that performs at events.Live Music → Cover Bands 433 Performing Arts → Event Bands 32 brass section 23 musician 1207 repertoire 2497 band 2977 event 45199 De Fryske Marren → Joure 689
bs-tech.nlBS-TechThe website of BS-Tech provides technical service focused on optimizing and improving production processes.Assembly & Production → Production Optimization 10 Maintenance & Services → Machine Maintenance 262 breakdown service 14 production process 168 project management 3423 machine 3727 maintenance 20093 De Fryske Marren → Oudehaske 49
bumabemiddeling.nlBuma BemiddelingThe website of Buma Bemiddeling provides brokerage services in the agricultural and construction (ground, road, and water) sector, with the goal of buying and selling companies, machinery, real estate, and raw materials.Land & Real Estate → Land Ownership 31 Agriculture → Agricultural Services & Contracting 708 raw materials 446 land 472 machinery 519 supply 961 De Fryske Marren → Nijemirdum 19
bureauvoorman.nlBureau VoormanAdviseur Bouwconstructies Lemmer is an advice bureau specializing in the design and consulting of building constructions.Engineering → Engineering Firms 989 Legal & Permits → Environmental Permits 88 building drawings 23 construction 7421 design 27202 De Fryske Marren → Lemmer 1188
bvlemmer.nlBadminton Vereniging LemmerThe website of Badminton Vereniging Lemmer (BVL) presents the association, its history, playing times and registration options for members.Combat → Badminton 702 badminton 453 municipality 6837 association 8562 member 10154 De Fryske Marren → Lemmer 1188
caferestaurantdebrekken-lemmer.nlCafé Restaurant "De Brekken"Café Restaurant "De Brekken" is a restaurant in Lemmer that offers an online menu and ordering options.Pastries & Baked Goods → Menus 223 snitzel 10 grill 562 soup 1043 burger 1431 salad 2444 menu 13856 De Fryske Marren → Lemmer 1188
cafetariatstraatje.nlCafetaria 't StraatjeCafetaria 't Straatje is a restaurant and bed & breakfast located in Balk, Friesland, offering delicious food, drinks, and accommodation options.Cafes & Lunch → Lunchroom 446 Quick Bites → Cafeteria 906 bed and breakfast 305 satay 320 friesland 692 fries 2753 restaurant 11215 De Fryske Marren → Balk 224
camperverhuur-nederland.nlCamperverhuur Nederland / CCR LemmerCamperverhuur Nederland offers camper rentals, allowing customers to experience freedom and comfort during their vacations.Camping → Camper Sales 94 Camping → Camper Rental 359 freedom 848 comfort 1473 camper 1596 model 3546 vacation 4234 De Fryske Marren → Lemmer 1188
ceal-in.nlCEAL-INThe CEAL-IN website presents wood-cement combopanels as a solution for thermal and acoustic insulation.Insulation & Glazing → Insulation 1543 insulation 2448 quote 12863 De Fryske Marren → Lemmer 1188
cncfrezenfriesland.nlCNC Frezen FrieslandCNC Frezen Friesland is a company that provides custom wood-turning services, specializing in applications within shipbuilding and the production of MDF molds.Construction & Engineering → CAD 111 Software Development & Engineering → Computer Technology 288 cnc milling 89 shipbuilding 148 mold 356 De Fryske Marren → Sint Nicolaasga 146
com4clima.nlCom4Clima SexbierumThe website Com4Clima from Sexbierum (Friesland) presents itself as a partner in building automation, offering solutions for creating an optimal indoor climate in buildings.Installation & Mounting → Installation Management 63 Energy & Sustainability → Climate Control 1896 building automation 39 climate system 78 indoor climate 97 installation 13742 maintenance 20093 De Fryske Marren → Balk 224
compact-hijsen.nlCompact HijsenCompact Hijsen is a company that rents out compact cranes and performs lifting operations.Logistics → Lifting Equipment 216 Lifting Equipment → Transportation Equipment 247 crane 662 sector 1332 portfolio 6854 De Fryske Marren → Sint Nicolaasga 146
cortijnhamstra.nlCortijn HamstraThe website of Cortijn Hamstra, a construction and renovation company, presents the services and projects of the entrepreneur, specializing in new construction, renovations, and alterations of homes and businesses in the Joure region, as well as furniture making.Kitchen → Kitchen Renovations 17 Interior → Furniture 7454 handyman 836 home 7976 furniture 8751 renovation 13849 De Fryske Marren → Joure 689
cosyhairsalon.nlCosy Hair SalonThe website of Cosy Hair Salon presents a hair salon in Lemmer, Friesland, where customers can easily make appointments online and view the services of hairdresser Anke.Hair Education → Hair Coloring 106 look 169 hair 3014 color 4159 salon 5541 appointment 13510 De Fryske Marren → Lemmer 1188
dapversgras.nlDierenartsenpraktijk Vers GrasDierenartsenpraktijk Vers Gras is a veterinary practice located in Heerenveen with the goal of improving animal health and veterinary care.Veterinarians → Veterinary Clinics 419 Agriculture → Livestock 2413 veterinary practice 71 cattle 167 veterinarian 864 collaboration 16036 Heerenveen → Akkrum 246
deblijebehanger.nlDe Blije BehangerThe Blije Behanger website offers wallpapering services in West Friesland, providing advice, preparation, and a gallery of projects.Interior → Wallpaper 1001 Household & Cleaning → Home Services 1321 photo wallpaper 75 wall 1378 wallpaper 1756 pattern 2012 De Fryske Marren → Lemmer 1188
decotec.nlDecotec Totaal Techniek B.V.The website of Decotec Totaal Techniek B.V. presents the services of the company as a recognized handyman and installation company that carries out various jobs and installations.Installation & Repair → Handyman Service 70 handyman 836 craftsmanship 1858 energy 9075 installation 13742 De Fryske Marren → Lemmer 1188
deentoeraazje.nlDe EntoeraazjeDe Entoeraazje is a lifestyle shop that offers unique clothing, home accessories, and gifts.Decor & Furnishings → Home Stores 932 Context 161394 home accessories 603 gift 6442 shop 6483 collection 7566 clothing 9443 De Fryske Marren → Joure 689
dehaansteenwijk.nlDe Haan SteenwijkDe Haan Steenwijk offers administrative and tax advisory services to individuals and small businesses.Finance → Taxation 1567 Company & Business → Individuals 827 deduction 29 annual account 399 tax return 787 administration 6587 De Fryske Marren → Lemmer 1188
dejongaanhangers.nlDe Jong ChiptuningThe website of De Jong Chiptuning offers tuning services, fuel saving options, and auto electronics solutions to customers in the province of Friesland.Repair → Garage 1779 Automotive Maintenance → Chiptuning 229 power 261 chiptuning 264 fuel 424 warranty 4701 software 8291 car 10865 Opsterland → Wijnjewoude 86
dejongdakbedekking.nlDe Jong DakbedekkingDe Jong Dakbedekking Oudehaske is a roofing company specializing in new construction, renovation, and maintenance of roofs in Friesland.Roofing → Flat Roofs 54 bitumen 64 damage 1562 roofing 2806 roof 3662 warranty 4701 quote 12863 Southwest-Friesland → Bolsward 566
demeerkikker.nlBrouwerij De MeerkikkerThe website of Brouwerij De Meerkikker presents the brewery's product range, with information about their beers, sales locations, and the brewery's history.Beer → Craft Beer 199 ipa 15 beer 2887 festival 3804 De Fryske Marren → Lemmer 1188
deverkeersexpert.nlDe VerkeersexpertThe website of De Verkeersexpert, located in Hoorn and West-Friesland, offers driving lessons to individuals looking to obtain their driver's license.Transportation → Driving & Lessons 1163 driver license 97 driving lesson 712 instructor 3126 price 8328 De Fryske Marren → Lemmer 1188
devriesstukadoors.nlDe Vries StukadoorsDe Vries Stukadoors is a plastering company based in Friesland, Netherlands, offering various plastering services including Beton Cire and decorative plaster.Interior → Wall Finishing 314 Construction Companies → Plasterers 843 beton cire 21 decorative plaster 120 plasterer 259 plaster 2175 Southwest-Friesland → Sneek 1921
diegaststube-joure.nlDie GaststubeThe website 'Die Gaststube' offers online ordering of dishes from the restaurant in Joure.Fast Food → Burger Restaurants 346 Regional Cuisine → German 17 schnitzel 61 sauce 1141 De Fryske Marren → Joure 689
domuko.nlShowband DomukoThis website of Showband Domuko and the Dokkumer Muziek Korps (DoMuKo) presents information about the majorettes and showband, including their performances and events.Orchestras & Bands → Orchestras 1553 Associations & Societies → Music Associations 1003 showband 10 majorette 13 solo 30 medal 213 ensemble 546 competition 4759 De Fryske Marren → Lemmer 1188
dorpsbladlangweer.nlDorpsblad LangweerThe Langweer Village News is a digital version of the local newspaper that distributes news, reports, interviews, and photos from the village of Langweer.Websites → Information Websites 12 Local & Regional → Local News Websites 358 edition 157 photo 7778 volunteer 8367 news 15293 De Fryske Marren → Langweer 93
dorpsraadschardam.nlStichting Dorpsraad SchardamThis website of the Stichting Dorpsraad Schardam provides information about the village of Schardam, North Holland, including news, history, board members, and the involvement of the council in the interests of the residents and the village.Local History → Historical Places 60 Village Council → Local Councils 21 council 426 municipality 6837 history 7286 De Fryske Marren → Lemmer 1188
dorpsraadwognum.nlWognum Village CouncilThe website of the Wognum Village Council provides information about the activities, decisions, and plans of the village council of Wognum, West Friesland, and serves as a platform for citizen engagement.Rental Properties → Tenant Associations 351 Local Government → Village Council 479 housing plan 18 kernvisie 20 annual report 877 meeting 2381 agenda 4374 community 7931 De Fryske Marren → Lemmer 1188
drachtenslotenmaker.nlSlotenmakerblijSlotenmakerblij is a locksmith business that provides services in Drachten and surrounding areas.Emergency Services → Emergency Locksmiths 124 locksmith 919 locks 953 security 6655 Twenterand → Stationslaan 266
dressuurcentrum.nlDressuuurcentrum het HugenotenhofDressuuurcentrum het Hugenotenhof is a horse riding training center that offers riding lessons, pony riding lessons, dressage lessons, horse sales, and horse boarding.Outdoor → Horse Riding 941 Equestrian → Stables 629 stable 768 ride 1075 horse 4337 floor 4781 lesson 5154 sale 5930 De Fryske Marren → Ruigahuizen 13
drukkerij1.nlDrukkerij1The website Drukkerij1 provides an overview of the locations where the printing company operates and offers contact options.Graphic Design & Printing → Graphic Companies 33 Planning → Route Planning 78 printing company 71 place 242 network 11123 Oirschot → East-West-and Middle Beers 214
dufour-charter.nlDufour ZeiljachtenThe Dufour Charter website offers the rental of Dufour sailboats, with a focus on luxurious and fully equipped yachts, located in Lemmer and offering trips in various waterways.Sailing → Sailing Lessons 13 waddenzee 142 sailboat 148 trip 2032 rental 7257 De Fryske Marren → Lemmer 1188
dutchrvsdesign.nlDutch RVS DesignDutch RVS Design is a website specializing in the design and production of high-quality RVS (stainless steel) products and interior designs.Woodwork → Tables 814 Design → Product Design 722 rvs 119 portfolio 6854 design 27202 De Fryske Marren → Lemmer 1188
e-brug.nlEchtenerbrug.infoThe Echtenerbrug.info website provides information about the villages of Echtenerbrug, Echten, and Delfstrahuizen, including an event calendar, business listings, and local photos.Neighborhood Organizations → Residents’ Associations 965 Nature → Waterways 161 map 801 photo 7778 event 45199 De Fryske Marren → Echtenerbrug 24
easymen.nleasymen.nlThis website presents the history and recordings of the Dutch band ‘Were We That Bad’, formed in 1986 in Drachten with the aim of reviving the lost band culture in the region.Genres → Blues 275 Music Education → Guitar Lessons 403 recordings 172 demo 320 guitar 1091 repertoire 2497 band 2977 performance 7586 Smallingerland → Drachten 2052
eetboetiek-lemmer.nlSnack & Eetboetiek De BrekkenSnack & Eetboetiek De Brekken is an online ordering platform for food in Lemmer.Fast Food → Fries 949 Bars & Pubs → Bars 1938 kibbeling 115 burger 1431 fries 2753 snack 2916 drink 5191 De Fryske Marren → Lemmer 1188
eethuis-nieuwburen-lemmer.nlEethuis LemmerThe website Eethuis Lemmer offers online ordering for a variety of dishes, including sandwiches, shawarma plates, Turkish pizzas, paninis, and pita wraps, all served in Lemmer.Lunch → Sandwiches 466 Ready-To-Eat Meals → Wraps 102 turkish pizza 63 pita 199 shawarma 335 plate 787 sandwich 4098 De Fryske Marren → Lemmer 1188
eethuislemmer.nlEethuis LemmerThe Eethuis Lemmer website in Lemmer provides an online ordering system for catering, allowing customers to easily order dishes from the menu and have them delivered to their home.Mediterranean & Middle Eastern → Takeout 286 promotion 2062 dish 5936 order 6912 menu 13856 De Fryske Marren → Lemmer 1188
ehbolemmer.nlLemmer First Aid AssociationThe website of the Lemmer First Aid Association provides information about first aid courses, events, volunteer opportunities, and the organization itself.Prevention → First Aid 1070 first aid 608 certificate 1036 volunteer 8367 course 14728 event 45199 De Fryske Marren → Lemmer 1188
eijl.nlVan Eijl BVVan Eijl BV’s website, operating as FJ08, provides financial services and inspiring workspaces to entrepreneurs.Real Estate → Business Finance 346 Workspace & Office Solutions → Workspace 144 workspace 795 building 3204 finance 5341 De Fryske Marren → Joure 689
ekschapendrijven.nlEK SchapendrijvenThis website pertains to the official website of the European Championship of Shepherding 2021, which has been cancelled due to the COVID-19 pandemic.Law → General Law 324 Infectious Diseases → Coronavirus 33 handler 30 sponsors 2642 municipality 6837 event 45199 De Fryske Marren → Lemmer 1188
elegantcars.nlElegant CarsElegant Cars is a car dealership offering a curated selection of cars for sale and accepting trade-ins.Automotive → Car Buying 110 test drive 177 trade-in 254 collection 7566 car 10865 appointment 13510 De Fryske Marren → Tjerkgaast 16
enkhuizenbeleving.nlEnkhuizen BelevingThe website of Enkhuizen Beleving offers a wide range of activities and team-building events in and around Enkhuizen.Games → Quizzes 344 Corporate Events → Team Building 1005 quiz 710 event 45199 De Fryske Marren → Lemmer 1188
entheosvocalgroup.nlEntheos Vocal GroupThe website of Entheos Vocal Group presents the group, its members, repertoire, schedule and themed service ‘Child of God.’ The aim is to inform potential members and event visitors.Live Music → Music Ensembles 61 Ensemble → Vocal Groups 225 gospel 345 singer 860 conductor 1217 song 1285 schedule 2624 Northeast-Friesland → Ternaard 35
er-geluidverhuur.nlER-GeluidverhuurER-Geluidverhuur is a company that rents professional light and sound equipment for various types of events.Property Rentals → Rental 1169 Event Planning → Sound 339 effect 154 equipment 4143 light 5148 rental 7257 event 45199 De Wolden → Ruinerwold 193
ericmeijermechanisatie.nlEric Meijer MechanisatieEric Meijer Mechanisatie provides a wide range of mechanization and repair services for agricultural machinery, cars, trucks, and trailers.Loading & Unloading → Forklifts 257 Machinery & Repair → Mechanization 60 mechanization 49 agricultural machinery 169 truck 1412 car 10865 repair 14576 maintenance 20093 De Fryske Marren → Bantega 19
esplora.nlEsploraThe website Esplora provides information about cities in the Netherlands and Belgium, primarily focused on city walks and urban tours.Tourism → City Tours 468 city walk 130 city 1875 Edam-Volendam → Volendam 948
essenburg.nlStichting De EssenburgThe website of the Essenburg-Foster and Youth Care Farm provides information about the organization and its goals.Social Organization → Children’s Organizations 467 Social Services → Youth Care 566 annual reports 311 farm 2622 sponsorship 2686 foundation 6678 child 11566 De Fryske Marren → Lemmer 1188
familyfinance.nlFamily FinanceFamily Finance is an accounting firm specializing in small businesses and individuals in Friesland, offering services such as accounting, tax filing, estate settlement, and startup assistance.Financial & Trading → Tax Software 41 Finance → Taxation 1567 tax filing 318 estate 1099 bookkeeping 1319 payroll 1823 account 5781 De Fryske Marren → Echten 54
feenstra-autotechnieksintnicolaasga.nlFeenstra AutotechniekThe website of Feenstra Autotechniek is an automotive garage and dealership in Sint Nicolaasga specializing in diagnostics, maintenance, and repair of hybrid, electric, and classic vehicles, and offers lease service and occasions.Repair → Garage 1779 Medical Care & Services → Diagnostics & Testing 348 electric vehicle 175 diagnostics 687 garage 1210 occasion 2036 maintenance 20093 De Fryske Marren → Sint Nicolaasga 146
feestpaalslaan.nlOudbouw-handelFeestpaalslaan.nl is a rental company specializing in the symbolic striking of the first timber pile during construction projects.Creative Spaces & Events → Celebrations 15 milestone 31 event 45199 Southwest-Friesland → Arum 37
fitmeilin.nlFitmeilinThe website of Fitmeilin offers personalized lifestyle coaching in Joure, aimed at helping individuals and groups achieve a healthier and fitter lifestyle, with a particular focus on women going through the transition.Women’s Health → Transition 26 Women’s Health → Menopause 228 lifestyle coaching 339 transition 610 health 6366 energy 9075 De Fryske Marren → Joure 689
flipnieuwboer.nlFlip Nieuwboer Schilder- und UnterhaltsbetriebFlip Nieuwboer Schilder- und Unterhaltsbetrieb is a company offering painting and maintenance services to homeowners, businesses, and other parties.Household & Cleaning → Home Services 1321 job 2795 warranty 4701 property 7406 paint 8747 renovation 13849 maintenance 20093 De Fryske Marren → Lemmer 1188
fmolemmer.nlFMO LemmerFMO Lemmer is a company providing mechanical support, new construction, and machine revision services to various industries.Maintenance & Services → Machine Maintenance 262 Engineering → Mechanical Engineering 737 test equipment 16 revision 163 assembly 1733 machine 3727 workshop 19325 maintenance 20093 De Fryske Marren → Lemmer 1188
fotoservicesinthubert.nlFotoservice Sint HubertThe website of Fotoservice Sint Hubert provides an overview of activities and events in the municipality of Sint Hubert, including photos of these events and special arrangements such as excursions and concerts.Social Organization → Senior Organizations 750 Family Activities → Outings 763 excursion 662 anniversary 670 quiz 710 concert 4409 photo 7778 event 45199 Land van Cuijk → Sint Hubert 61
franeisti.nlAnne-JetThe website franeisti.nl is an information portal and sales channel for Icelandic horses and services related to caring for and training these horses, located in Friesland.Outdoor → Horse Riding 941 Equestrian → Riding School 19 icelandic horse 11 instructor 3126 horse 4337 accommodation 4921 sale 5930 training 28133 De Fryske Marren → Rijs 32
fremo-nederland.nlFremo in the Netherlands and BelgiumThe website of Fremo in the Netherlands and Belgium serves to connect passionate model railroaders from across Europe and provide a platform for exchange and learning.Model Building → Model Railroading 273 model railroad 31 scale 194 line 236 meeting 2381 Heerde → Wapenveld 203
garageboxen-lemmer.nlGarageboxen LemmerGarageboxen Lemmer is a company that rents garage boxes and storage spaces for both individuals and businesses.Logistics → Storage 1170 storage space 388 box 1982 storage 2446 De Fryske Marren → Lemmer 1188
gastenverblijfburgum.nlB&B Gastenverblijf As in Roaske BurgumB&B Gastenverblijf As in Roaske is a bed and breakfast located in Burgum, Friesland, offering accommodation and a base for exploring the region.Hiking → Trails 356 Context 161394 entrance 88 bed and breakfast 305 friesland 692 bedroom 2051 De Fryske Marren → Terkaple 24
gauwd.nlGauwdThe website presents a farm in Gauw that is offered as a unique and inspiring location for meetings and events.Conferences & Meetings → Meeting Locations 171 Agriculture → Farms & Farm Businesses 1115 meeting 2381 farm 2622 hosting 3125 coffee 3838 catering 6456 De Fryske Marren → Goingarijp 86
georgereurings.nlGeorge ReuringsThis website, George Reurings Genealogy, provides an online family tree with information about the ancestors of the website owner, specifically the Reurings family, and ancestors of other branches of the family.Reference → Information Resources 352 Social Sciences → Genealogy & Family History 1403 dna test 21 place 242 resources 310 family tree 448 document 1678 family 6462 De Fryske Marren → Lemmer 1188
geveltrend.nlGeveltrendGeveltrend is a company that manufactures, installs, and sells facade elements.Facades & Cladding → Facade Elements 13 Economy → Retail & Commerce 9941 facade elements 40 skylight 966 window 2030 showroom 4883 De Fryske Marren → Lemmer 1188
gno-hypotheken.nlG&O HypothekenG&O Hypotheken is an independent mortgage advisory firm located in West-Friesland, Netherlands.Essential → Home 70708 mortgage 4564 finance 5341 insurance 6359 home 7976 De Fryske Marren → Lemmer 1188
goedkopevakantiehuizennederland.nlHoliday Home Rentals NetherlandsThe website provides an overview of affordable holiday homes in the Netherlands.Accommodation → Holiday Parks 1024 rental company 52 holiday rental 65 people 627 holiday home 2753 region 5412 Veere → Oostkapelle 205
grillroommarmaris-joure.nlGrillroom "Marmaris"Grillroom "Marmaris" is a restaurant in Joure that accepts online orders for a comprehensive menu including pizzas, sandwiches, and plates.Ready-To-Eat Meals → Wraps 102 Sandwiches & Salads → Sandwich Shops 229 shawarma 335 plate 787 salad 2444 sandwich 4098 pizza 4158 drink 5191 De Fryske Marren → Joure 689
groenling-wente.nlHuur een HuisjeDe Groenling is a website offering holiday homes for rent on bungalow park 'Het Fonteinbos' in Gaasterland, near the village of Oudemirdum.Accommodation → Bungalows 1008 Accommodation → Bungalow Parks 931 wooded area 19 cycling path 27 park 1863 holiday home 2753 De Fryske Marren → Oudemirdum 73
guerrillatroubadour.nlTheater Het PakhuisThe website presents information about the Guerrillatroubadour, a musician and entertainer who performs with new stories and songs, often in theaters and at cultural events.Lyrics & Poetry → Songs 113 Theater → Cabaret 358 theater 2544 performance 7586 story 8285 music 13170 De Fryske Marren → Lemmer 1188
hadee-store.nlHadee StoreThe Hadee Store website offers used Harley Davidson parts, including repair, maintenance, sales, purchase, and trade-in of these parts, as well as customizing motorcycles.Parts → Motorcycle Parts 488 Motorcycles → Harley-Davidson 45 trade-in 254 customization 1723 motorcycle 2110 part 5044 repair 14576 De Fryske Marren → Oosterzee 29
haismasadministratiekantoor.nlHaisma AdministratieHaisma's Administratiekantoor is an administrative service provider focused on handling administrative tasks for individuals and businesses (SMEs).Accounting → Business Accounting 688 accountant 611 specialist 938 rate 2606 office 2898 administration 6587 De Fryske Marren →  Sintjohannesga 24
hans-architectuur.nlHans ArchitectuurThe website of Hans Architectuur showcases a portfolio of residential projects, including new construction, renovations, and the repurposing of existing buildings, with a focus on sustainability and energy efficiency. The company provides architectural services to individuals and housing corporations.Software → Real Estate Software 100 Industry → Industrial 1987 vr 249 heat pump 2541 home 7976 sustainability 18451 design 27202 Ede → Deelen 18
hansharkema.nlHans HarkemaThe website of Hans Harkema presents his services in the areas of gardening, carpentry, tiling, and agricultural work.Agricultural Services & Contracting → Farm Services 76 agricultural work 30 gardening 505 carpentry 2218 tile 2869 De Fryske Marren → Harich 35
hazelhoffraamdecoratie.nlHazelhoff RaamdecoratieHazelhoff Raamdecoratie is a window covering specialist based in Friesland, offering custom solutions and advice for both indoor and outdoor shading.Interior → Curtains 831 Interior → Window Coverings 1026 shading 364 curtains 1015 window coverings 1213 Noordoostpolder → Emmeloord 1649
heerlijkclub.nlHEERLIJK ClubThe website offers discount deals on restaurants and culinary experiences throughout the Netherlands.Ticketing & Sales → Packages 35 province 518 dinner 1533 package 6112 restaurant 11215 menu 13856 Oss → Megen 82
heerschapbarbier.nlHeerschap BarbierHeerschap Barbier is a barbershop specializing in the care of men.Men’s Grooming → Barbershops 1012 Fashion → Men’s Fashion 690 shave 179 voucher 279 barber 418 t-shirt 698 haircut 1158 De Fryske Marren → Joure 689
hetivorkheftrucks.nlHeti VorkheftrucksHeti Vorkheftrucks is a company specializing in the repair and sale of Hyster forklifts and parts.Forklift Services → Internal Transport 41 Loading & Unloading → Forklifts 257 forklift 447 part 5044 repair 14576 De Fryske Marren → Lemmer 1188
hierbyesther.nlHIER by EstherHIER by Esther is a hair salon located in Joure that provides clients with professional haircuts, advice, and relaxation, with the option of hair extensions.Dermatology → Scalp Care 402 hair extension 384 relaxation 3968 salon 5541 appointment 13510 De Fryske Marren → Joure 689
hildephotography.nlHildephotographyHildephotography is a pet photographer based in Nijemirdum, Netherlands, specializing in creating beautiful and memorable photos of animals with a focus on relaxed and animal-loving sessions.Animal Imagery → Animal Photography 186 Animals → Pets 1382 animal 2908 horse 4337 dog 5483 package 6112 photo 7778 De Fryske Marren → Nijemirdum 19
hispanoasesoria.nlHispano Asesoría en HolandaHispano Asesoría en Holanda is a company located in Oudehaske, Netherlands, providing legal and tax consulting services to Spanish speakers seeking to establish a business in the Netherlands, streamlining the process.Law → Business Law 1361 Supply Chain & Logistics → International Trade 1156 loan 832 legal 937 payroll 1823 tax 2100 De Fryske Marren → Oudehaske 49
horstingelektrotechniek.nlHorsting ElektrotechniekHorsting Elektrotechniek is an electrical company offering services to both business and private clients.Technical Services → Technical 957 Technology → Smart Home & Automation 1146 troubleshooting 98 intercom 118 electrical 1414 camera 1733 installation 13742 De Fryske Marren → Lemmer 1188
hovenierevert.nlHoveniersbedrijf Evert BakkerHoveniersbedrijf Evert Bakker is a landscaping company that offers a variety of garden services.Garden Maintenance → Tree Care 660 Garden Maintenance → Gardeners 685 tree care 245 landscaping 1529 paving 1942 plant 4509 garden 13129 maintenance 20093 De Fryske Marren → Lemmer 1188
hrtimmerwerken.nlHR TimmerwerkenHR Timmerwerken is a carpentry company providing new construction, renovation, and maintenance services in Southwest Friesland.Building & Materials → Carpentry & Joinery 830 carpentry 2218 frames 2556 new construction 2672 renovation 13849 maintenance 20093 Southwest-Friesland → Workum 363
huismanbouwadvies.nlHuisman BouwadviesHuisman Bouwadvies is an independent advisory firm providing advice and guidance to builders and homeowners on their construction and renovation projects in West-Friesland.Legal & Permits → Building Engineering 120 Essential → Home 70708 permits 643 plan 2566 home 7976 renovation 13849 De Fryske Marren → Lemmer 1188
huitemabouwadvies.nlHuitema Bouw & AdviesThe website of Huitema Bouw & Advies Joure offers construction services and advice to private and business clients, with a focus on new construction and renovations.Construction Companies → Assembly Companies 32 business building 27 construction 7421 house 8121 renovation 13849 De Fryske Marren → Joure 689
hvwestfriesland.nlStichting Hart van West FrieslandThe website of Stichting Hart van West Friesland presents events and activities taking place in the West-Friesland region.Initiatives & Projects → Local Initiatives 1001 Neighborhood Focus → Neighborhood Initiatives 1001 cooperation 433 rules 593 region 5412 newsletter 6504 event 45199 De Fryske Marren → Lemmer 1188
hwindmetaalbewerking.nlH. Wind MetaalbewerkingH. Wind Metaalbewerking is a company specializing in metalworking and providing custom solutions for various projects.Metalworking → Welding 893 Manufacturing → Metals & Fabrication 1224 conservation 182 steel structure 208 metalworking 565 welding 1051 construction 7421 De Fryske Marren → Sint Nicolaasga 146
hylkemabouw.nlHylkema BouwHylkema Bouw is a company specializing in the assembly, disassembly, and understamping of scaffolding and lifts.Building & Materials → Scaffolding 328 lift 445 scaffolding 519 employee 4429 De Fryske Marren → Bakhuizen 45
ideefiks-marknesse.nlIdeefiks Klus- en Adviesbureau MarknesseIdeefiks Klus- en Adviesbureau is a handyman and consultancy agency based in Marknesse that offers various handyman services and advice to individuals and businesses.Design & Projects → Self-Employed Entrepreneurs 505 Renovation & Restoration → Interior Renovation 879 handyman 836 idea 2367 repair 14576 collaboration 16036 Noordoostpolder → Emmeloord 1649
ijsverenigingvenhuizen.nlIJsvereniging Venhuizen e.o.The website of IJsvereniging Venhuizen e.o. showcases the activities of the club, including skating lessons, events, and news, and provides information about membership and youth skating opportunities.Ice Rinks → Ice Skating Clubs 218 Skating → Inline Skating 58 ice rink 265 skating 314 membership 10442 event 45199 De Fryske Marren → Lemmer 1188
inbetweengoor.nlIn BetweenInbetween.nl is a brass band and choir that organizes concerts, events, and services primarily in the Petrus and Pauluskerk in Goor.Culture → Religion 8327 song 1285 rehearsal 1639 choir 3123 concert 4409 event 45199 De Fryske Marren → Lemmer 1188
ireneschouten.nlTeam XGThe website of Irene Schouten provides insights into the life and athletic career of the triple Olympic champion speed skater, Irene Schouten. It also offers the possibility to book Irene as a speaker.People → Personality 64 Team → Speed Skating 122 olympics 21 world championship 25 speed skating 65 partnership 1407 speaker 1481 De Fryske Marren → Lemmer 1188
jachtservicedejong.nlJachtservice de JongJachtservice de Jong provides maintenance and service for boats in Friesland, specializing in engine maintenance, antifouling, and winterization.Water → Boats 935 Marine & Watercraft → Boat Sales 144 antifouling 44 engine 758 boat 2980 technology 6816 paint 8747 maintenance 20093 De Fryske Marren → Langweer 93
jodydevries.nlJody de VriesThe website of goldsmith Jody de Vries in Lemmer, Friesland, showcases her services for repairing, creating, and personalizing jewelry, with a focus on creating emotionally meaningful memories.Jewelry → Goldsmiths 319 craft 538 memory 1641 emotion 2169 jewelry 4599 De Fryske Marren → Lemmer 1188
jousterfanfareorkest.nlJouster Fanfare OrkestThe website of the Jouster Fanfare Orkest presents the activities, agenda, media and history of the music association, as well as opportunities to support the orchestra.Associations & Societies → Music Associations 1003 Performance → Fanfares 145 youth orchestra 39 conductor 1217 orchestra 1315 sponsorship 2686 agenda 4374 concert 4409 Amsterdam → Sloten 146
jurjenlaan.nlJurjen Laan SchilderijenThe website of Jurjen Laan Schilderijen showcases the artwork of artist Jurjen Laan, focusing on paintings, drawings, and sketches, along with information about his studio and teaching materials.Visual Arts → Drawing 1046 Painting → Modern Art 99 drawings 1329 artwork 2248 model 3546 paintings 3907 studio 5465 course 14728 De Fryske Marren → Lemmer 1188
justusmusic.nlJustUsThe website of JustUs presents information about the musical duo Justus Werle and Hans Visser, their repertoire, and performances.Ensemble → Ensemble Music 31 Genres → French Music 29 duo 328 repertoire 2497 concert 4409 music 13170 De Fryske Marren → Lemmer 1188
karinderuiter.nlAutorijschool Karin de RuiterAutorijschool Karin de Ruiter provides driving lessons and driver training programs in the West-Friesland region and surrounding areas.Driving & Lessons → Motorcycle Lessons 351 driving car 26 theory 956 exam 2120 driving lessons 2453 lesson 5154 Medemblik → Twisk 47
kerkhemelum.nlProtestant Church Community Hemelum e.o.The website of the Protestant Church Community of Hemelum and surrounding areas provides information about the church community, the consistory, church services, recordings of services, and activities such as Sunday school.Reformed → Church Organization 155 church community 12 sunday school 32 church service 879 church 3439 coffee 3838 Noordoostpolder → Emmeloord 1649
kermisrepo.nlMelvin WiersmaKermisrepo.nl is a website that compiles and presents kermissen (carnivals) from the Netherlands and abroad.Directories → Portals 369 Festivals → Carnival 1150 announcement 115 wordpress 3551 Maashorst → Uden 1540
ki-zwf.nlKI service Z.W. FrieslandKI service Z.W. Friesland is an independent semen sales and AI service company offering products and services in South West Friesland and the North East Polder.Agriculture → Livestock 2413 insemination 19 semen 47 livestock 207 scan 790 De Fryske Marren → Lemmer 1188
kindergeneeskundesneek.nlAntonius ZiekenhuisThe website of Antonius Ziekenhuis in Sneek provides information about pediatric care, including a clinic, day procedures, neonatal care, and the various departments within the hospital.Medical Care & Services → Pediatric & Child Health 2121 pediatrician 17 hospital 560 clinic 1079 Noordoostpolder → Emmeloord 1649
kinderopvanglemmer.nlKinderopvanglemmerThe Kinderopvanglemmer website provides information about a small-scale childcare setting in a home-like environment, prioritizing the development and well-being of the children.Hotels → Family Hotels 93 playroom 68 facility 2616 childcare 3512 child 11566 garden 13129 De Fryske Marren → Lemmer 1188
kinkyliefde.nlkinkyliefde.nlThe website is a dating platform focused on finding partners for alternative relationships and sexual interests, including BDSM.Dating → Alternative Dating 34 bdsm 71 profile 1965 relationship 4205 Southwest-Friesland → Arum 37
kissnagelenwimpersalon.nlKiss Nagel- en Wimpersalon JoureKiss Nagel- en Wimpersalon Joure is a salon in Joure that offers nail and eyelash extension treatments.Nail Services → Eyebrow Services 62 Beauty → Eyelash Services 1131 eyelash 354 nails 1719 salon 5541 appointment 13510 treatment 21203 De Fryske Marren → Joure 689
klokreparatiejoure.nlFreerk Pasveer - Clock Repair JoureThe website of Freerk Pasveer - Clock Repair Joure offers repair and restoration services for clocks, specializing in Friesian tail- and stool-clock.Crafts → Clockmaking 51 Antiques & Collectibles → Clock Shops 12 timepiece 26 clock 151 technical 291 restoration 3417 De Fryske Marren → Joure 689
kooijengatrading.nlKooijenga TradingThe website of Kooijenga Trading in Lemmer specializes in buying and selling remainder lots of various goods, including tools, furniture, and clothing, primarily originating from bankruptcies and overstocks.Commerce → Wholesale 1855 Trade → Trading Companies 179 bankruptcy 150 goods 666 ship 5103 De Fryske Marren → Lemmer 1188
kooijschilderwerken.nlKooij SchildersbedrijfKooij Schildersbedrijf is a painting company located in Joure specializing in maintenance, renovation, and sustainable solutions for homes and businesses.Home Improvement & Services → Home Maintenance 1002 sustainable 739 wall 1378 paint 8747 renovation 13849 maintenance 20093 De Fryske Marren → Joure 689
koolkollektief.nlHet KoolKollektiefThe website of Het KoolKollektief presents the theater piece ‘De Laatste tuinder van Langedijk’ (The Last Gardener of Langedijk), a play about the challenges facing the agricultural and horticultural sectors, which will be performed from May 12 to 15 at Museum BroekerVeiling.Theater → Play 45 Agricultural Services & Contracting → Farm Services 76 gardener 299 crisis 358 museum 2002 band 2977 De Fryske Marren → Lemmer 1188
kostentuinman.nlKosten TuinmanThe website ‘Kosten Tuinman’ provides an overview of gardening services in various regions of the Netherlands.Office & Workspace → Business Directories 421 gardener 299 Emmen → Nieuw-Amsterdam 149
kostenvochtbestrijding.nlTo be determinedThis website, 'Cost of Wetting Control Overview', provides information about wetness control and allows users to compare offers from various companies. The website focuses on solving wetness problems in different regions of the Netherlands.Context 161394 odor 81 mold 356 region 5412 Sittard-Geleen → Obbicht 34
kotjoure.nlBiljartvereniging KOT JoureThe website of Biljartvereniging KOT Joure provides information about the association, its competitions, photos, schedules, and historical data.Associations → Sports Associations 1082 Team → Billiards 365 billiard 341 season 692 match 3471 competition 4759 photo 7778 association 8562 De Fryske Marren → Joure 689
kuunder41.nlN.V. Vakantiehuis LangelilleThis vacation home in Langelille offers an ideal base for water and nature vacations, with opportunities for watersports, cycling, and walking.Water → Lakes 232 Accommodation → Bungalow Parks 931 vacation home 488 cycle 1906 water 2501 house 8121 nature 9094 De Fryske Marren → Balk 224
laadpaaloverzicht.nlLaadpaaloverzicht.nlLaadpaaloverzicht.nl is a website that provides an overview of charging stations in the Netherlands, including locations such as zoos, amusement parks, and wellness resorts. The goal is to help electric car drivers plan their routes and find charging options.Electric Vehicles → Charging 291 Tourist Destinations → Tourist Attractions 22 charging points 14 amusement park 96 zoo 122 charging stations 421 holiday park 566 Schouwen-Duiveland → Scharendijke 103
lasmo-stnyk.nlLasmo Las en MontagetechniekLasmo Las en montagetechniek is a company specializing in the assembly, repair, maintenance, and renovation of water purification systems and waterworks.Machine Shops & Welding → Welding Technology 115 Consulting → Technical Consulting 382 water purification system 10 waterworks 100 assembly 1733 repair 14576 workshop 19325 De Fryske Marren → Sint Nicolaasga 146
le-bestratingen.nlL.E. BestratingenL.E. Bestratingen is a paving contractor specializing in the landscaping of driveways, garden paths, terraces, and planters in the North Holland and West Friesland region.Garden Maintenance → Garden Landscaping 711 Garden → Paving 1003 driveway 93 roadwork 156 planter 233 paving 1942 Medemblik → Andijk 242
legiraffe-hr.nlLe Giraffe – HR AdviesLe Giraffe – HR Advies is a specialized HR company focusing on HR Interim, HR Optimization, and Change Management.Business Software → HR Software 649 Recruitment → HR Services 3384 methodology 332 change management 531 optimization 611 hr 884 vision 1882 De Fryske Marren → Lemmer 1188
lehos.nlLEHOS - Wijn & Vis handelLEHOS - Wijn & Vis handel is a company specializing in the trade of wine and fish, with a focus on supplying the hospitality and retail sectors.Fish & Seafood → Fish 388 retail 586 fish 1121 hospitality 3491 wine 4476 assortment 7799 De Fryske Marren → Lemmer 1188
lekdetectie-friesland.nlLM BedrijvenThe website of LM Bedrijven aims to inform potential customers in Friesland about and assist them with leak detection in their homes, offering 24/7 emergency service and a damage-free approach.Plumbing → Leak Detection 74 Transportation → Emergency Services 630 detection 128 moisture 227 friesland 692 leak 1204 damage 1562 water 2501 Southwest-Friesland → Bolsward 566
lemsterwens.nlStichting Lemster WensStichting Lemster Wens is a foundation that supports people and goals in the Lemmer region who need assistance.Initiatives & Collaboration → Initiatives 459 lion 34 supporter 139 initiative 1297 wishes 2717 donation 5110 De Fryske Marren → Lemmer 1188
lennalemmer-lemmer.nlLenna LemmerThe Lenna Lemmer website is an online platform allowing users to order dishes from the Lenna Lemmer restaurant in Lemmer and receive online orders.Pastries & Baked Goods → Menus 223 Sandwiches & Salads → Italian Cuisine 99 dessert 496 appetizer 556 sauce 1141 pasta 1389 pizza 4158 drink 5191 De Fryske Marren → Lemmer 1188
lingerieaandeluts.nlLingerie aan de LutsLingerie aan de Luts is a lingerie, nightwear, hosiery and swimwear shop located in Balk, Netherlands, emphasizing personalized service and a welcoming atmosphere.Underwear → Lingerie 471 personalized service 18 nightwear 160 lingerie 488 hospitality 3491 assortment 7799 brand 17737 De Fryske Marren → Balk 224
linktoresult.nlLink to ResultThe website Link to Result, operated by Jolanda Troelstra-Luinstra, offers training programs in areas such as networking, communication, and presentation, and serves as a platform for fundraising for projects and events.Charities → Fundraising 1005 Training → Business Training 315 fundraising 322 networking 842 presentation 1785 collaboration 16036 training 28133
liveversiewebsite.nlReno-Dijk vofThe website of Reno-Dijk vof presents the services of a company specializing in masonry, pointing, restoration, renovation, and new construction projects, with a focus on the repair and reproduction of natural stone.Stone & Tiles → Stone 101 Masonry & Plastering → Masonry 576 masonry 460 natural stone 614 restoration 3417 renovation 13849 De Fryske Marren → Broek 21
logopediejosedegroot.nlLogopedie José de GrootLogopedie José de Groot provides speech, language, swallowing, and voice therapy for a range of problems, with a focus on communication and nutrition.Childcare → Language Development 574 swallowing 129 speech 532 voice 1090 language 2016 communication 10162 treatment 21203 Southwest-Friesland → Koudum 134
loonbedrijfboonstradijkstra.nlLeanbedriauw Boonstra & DijkstraThe website of Leanbedriauw Boonstra & Dijkstra presents an agricultural contracting business based in Rottum, Friesland, that offers various agricultural and gardening services to private customers and companies in the region.Rental Services → Machinery Rental 14 Agriculture → Agricultural Services & Contracting 708 machinery 519 tractor 789 paving 1942 De Fryske Marren → Lemmer 1188
luxevakantiepark.nlLuxe VakantieparkenThis website provides an overview of luxury holiday parks in the Netherlands and other European countries.Holiday Homes → Beach Houses 277 Holiday Parks → Luxury Holiday Parks 11 lake 352 holiday park 566 park 1863 holiday 2295 facility 2616 house 8121 Sluis → Cadzand 234
lydiamuller.nlYola de LusenetThe website of Lydia Muller showcases her artwork as a painter and graphic artist, with an emphasis on family genealogy and archives.Social Sciences → Genealogy & Family History 1403 Painting → Individual Artists 668 graphics 123 archive 2067 paintings 3907 exhibition 5332 De Fryske Marren → Joure 689
mapuni.nlMapuniThe website mapuni.nl provides a route planner, an interactive map of the Netherlands, and information about fuel consumption of various cars. The goal is to help users plan routes and find interesting places in the Netherlands.Planning → Route Planning 78 Road Services → Automotive 18764 fuel consumption 34 map 801 route 3425 car 10865 De Fryske Marren → Sint Nicolaasga 146
marlestate.nlStichting MarlestateThe Marlestate website is a care farm offering day care, education, and support to individuals with an indication, in a peaceful rural environment.Farms & Farm Businesses → Care Farms 473 Education → Special Needs & Support 6372 dairy farm 129 farm 2622 environment 4873 care 12338 De Fryske Marren → Lemmer 1188
mensendierbewust.nlMens en Dier BewustThe website Mens en Dier Bewust offers training, coaching and energetic treatments for dogs and horses, employing a holistic approach focused on addressing the underlying causes of behavioral issues.Dogs → Behavior Training 175 healing 1148 behavior 1779 horse 4337 dog 5483 coach 25810 training 28133 De Fryske Marren → Lemmer 1188
mercurypainting.nlMercury Painting & DecoratingMercury Painting & Decorating is a professional painting and decorating business based in Lemmer, Netherlands, offering services for both residential and commercial properties.Exterior Works → Glass Fitting 112 Building & Construction → Renovation 4403 decorate 48 residential 216 commercial 342 woodwork 387 property 7406 paint 8747 De Fryske Marren → Lemmer 1188
meubelmakerij-kruizinga.nlMeubelmakerij KruizingaThe website of Meubelmakerij Kruizinga showcases a furniture maker and fine woodworker based in Amsterdam, North Holland, and West Friesland. The site displays projects, the process, and information about the entrepreneur.Decor & Accessories → Handcrafted Furniture 23 cabinet 1730 table 1778 furniture 8751 De Fryske Marren → Lemmer 1188
mfpartyverhuur.nlMijn Feestje Partyverhuur HeerenveenMijn Feestje Partyverhuur Heerenveen is a party rental company that rents various products, including beer tables and party tents, in the Friesland region.Property Rentals → Rental 1169 Logistics & Transportation → Rental Companies 414 beer table 11 heater 184 party tent 256 party 5928 event 45199 Heerenveen → De Knipe 27
minnesmazandgrind.nlZand- en grindhandel MinnesmaZand- en grindhandel Minnesma is a supplier of sand and gravel for various construction purposes, offering options for pickup and delivery, and a concrete station for ready-to-use concrete mix.Building & Materials → Sand 113 Building & Materials → Gravel 131 gravel 302 station 420 sand 630 concrete 973 transport 6105 De Fryske Marren → Joure 689
mjmontage.nlMJ MontageThe website of MJ Montage presents a carpentry and construction company specializing in building, renovating, and remodeling homes and outdoor spaces in West-Friesland.Outdoor Living → Verandas 497 Construction Companies → Additions 458 remodeling 335 carpentry 2218 quote 12863 renovation 13849 design 27202 De Fryske Marren → Lemmer 1188
mlhtrans.nlMLH TransThe website of MLH Trans presents the company as an international transport company specializing in exceptional transport and megatautliner transport.Transportation Services → Refrigerated Transport 226 Freight & Logistics → International Transportation 576 fleet 1351 logistics 3257 transport 6105 Southwest-Friesland → Heeg 227
mooigebouw.nlErik Verbeek ArchitectThe website of Erik Verbeek Architect presents projects and offers architectural services for new construction, renovation, and expansion, with a focus on sustainability and improving existing buildings.Building Inspection & Safety → Building Surveying 33 buildings 898 new construction 2672 space 3846 renovation 13849 sustainability 18451 De Fryske Marren → Nijemirdum 19
natuur-el.nlNatuur-elThe website Natuur-el offers activities and projects in the fields of nature experience and food education, aiming to connect people with nature and educate children and young people about food.Primary Education → Food Education 18 Environmental Studies → Nature Education 159 food education 12 nature experience 35 gardening 505 seed 599 education 13471 De Fryske Marren → Lemmer 1188
natuurfotowebshop.nlNatuurfotowebshop.nlThe website Natuurfotowebshop.nl is an online shop selling photographic posters and postcards of nature, birds, and landscapes.Nature & Landscape → Nature Photography 482 Graphic Arts → Posters 198 poster 837 bird 922 card 1975 landscape 2609 decoration 4085 shop 6483 De Fryske Marren → Wijckel 25
neo-jongneo.nlRSV NEORSV NEO is a riding association that promotes and practices horse and pony sports in Friesland.Equestrian → Riding Clubs 245 Outdoor → Horse Riding 941 horse 4337 competition 4759 lesson 5154 association 8562 member 10154 Weststellingwerf → Vinkega 15
noordster-lemmer.nlBuurtvereniging ‘De Noordster’This website provides information about the activities and history of Buurtvereniging ‘De Noordster’, a neighborhood association in Lemmer.Neighborhood Organizations → Residents’ Associations 965 Neighborhood Focus → Community Centers 941 cooperation 433 community center 442 neighborhood 2424 association 8562 De Fryske Marren → Lemmer 1188
oertnet.nlBadmintonclub Oer 't NetBadmintonclub Oer 't Net is a recreational badminton club located in Balk that provides facilities for members and invites new members to experience the sport.Combat → Badminton 702 badminton 453 trainer 1966 club 4225 sport 4228 member 10154 De Fryske Marren → Balk 224
ofv.nlOFV Internet Producten BVOFV Internet Producten BV offers innovative web applications for the management of maintenance plans for real estate.Business Software → ERP Systems 1007 maintenance plan 87 web application 609 integration 1451 analysis 1615 real estate 4981 De Fryske Marren → Balk 224
ongediertebestrijdingzwf.nlOngedierte Bestrijding Zuidwest FrieslandThe website, Ongedierte Bestrijding Zuidwest Friesland, provides professional pest control and prevention services in the South West Friesland region.Control → Pest Control 824 fungus 72 pests 201 protection 728 control 911 prevention 1763 De Fryske Marren → Balk 224
ontruimingmetzorg.nlUW ONTRUIMING, ONZE ZORGThe website UW ONTRUIMING, ONZE ZORG offers home clearance services, including assistance with moving, household clearance, and support for clearing vacant properties, particularly for seniors and at the time of death. The website also offers support with administrative tasks and contract terminations.Home Services → Clearance 280 Social Services → Assistance Services 627 clearance 349 household 382 help 864 contract 2415 home 7976 coach 25810 Stadskanaal → Musselkanaal 152
openingstijden-action.nlOpeningstijden ActionThis website provides current opening hours for all Action stores in the Netherlands.Pharmaceuticals & Medical Products → Pharmacies 1029 Food → Supermarkets & Grocery 3568 action 384 warehouse 1027 database 1153 opening hours 2953 store 3901 The Hague → Scheveningen 1625
opslagkoudum.nlOpslag KoudumThe Opslag Koudum website offers various storage solutions, including self-storage containers, office space and storage, targeting private and business customers.Real Estate → Commercial Property 1840 Logistics → Storage 1170 storage space 388 office space 773 vehicle 3743 Southwest-Friesland → Koudum 134
orcaruiters.nlRV and PC de OrcaruitersThe website of RV and PC de Orcaruiters serves as an information center for members, visitors, and sponsors of the equestrian club Orcaruiters Urk. It shares news, events, and results.Outdoor → Horse Riding 941 dressage 195 rider 594 competition 4759 event 45199 Zwartewaterland → Genemuiden 405
origineleteamuitjes.nlOriginal Team OutingsThe website provides an overview of original team outings and corporate activities, with the possibility to request a custom quote.Travel Agencies → Group Travel 207 Conferences & Meetings → Corporate Events 2472 team outing 221 event 45199 Zevenaar → Lathum 89
osteopathiesteenhuisen.nlOsteopathie SteenhuisenThis website provides information about osteopathy, what a treatment entails, and what indications are available.Physical Therapy → Osteopathy 922 Medical Care & Services → Pediatric & Child Health 2121 indication 164 osteopathy 809 body 3490 complaint 6479 appointment 13510 Southwest-Friesland → Bolsward 566
osteopathiewestfriesland.nlOsteopathie West-FrieslandThe website of Osteopathie West-Friesland provides information about osteopathy, the practice locations, and osteopath Richard Wuisman. The goal is to inform potential patients and facilitate appointments.Physical Therapy → Osteopathy 922 osteopathy 809 complaint 6479 practice 9089 appointment 13510 De Fryske Marren → Lemmer 1188
oudeschoolbantega.nloudeschoolbantega.nlThe website presents Vakantie-erf De Oude School, a holiday estate in Bantega, Friesland, offering accommodations for groups of up to 16 people, with the option to bring tents or caravans.Nature → Estates 771 tjeukemeer 11 friesland 692 accommodation 4921 De Fryske Marren → Lemmer 1188
outdoortimes.nlOutdoor TimesOutdoor Times is a website offering activities and team-building programs in Texel and West Friesland, focused on active outdoor experiences and creating enjoyable and memorable events for groups.Corporate Events → Team Building 1005 Nature & Outdoors → Outdoor 4031 team building 720 beach 3210 De Fryske Marren → Lemmer 1188
pabrinksma.nlHouthandel BrinksmaHouthandel Brinksma is a timber and handyman business serving both private and business clients.Household & Cleaning → Home Services 1321 Retail → Hardware Stores 98 timber 353 building materials 486 handyman 836 email 1012 phone 1163 De Fryske Marren → Langweer 93
parsbv.nlHandelmaatschappij Pars BVPars BV Lemmer is a wholesaler specializing in potatoes, storage and cold storage facilities.Logistics → Storage 1170 Logistics → Cold Chain Logistics 14 cold storage 10 potato 542 storage 2446 De Fryske Marren → Lemmer 1188
patriciaswanenberg.nlPraktijk SwanenbergPraktijk Swanenberg is a wellness practice located in Friesland that offers craniosacral therapy, family constellations, and yoga.Alternative Medicine → Holistic 1153 Alternative Medicine → Craniosacral Therapy 36 craniosacral 40 family constellation 305 yoga 3704 Southwest-Friesland → Oppenhuizen 41
pcdokter-friesland.nlPC Dokter FrieslandThe website offers computer repair and support services at customers’ homes in Friesland and surrounding areas.Computer → Computer Support 1003 computer 1969 problem 2214 partner 4272 home 7976 repair 14576 workshop 19325 Northeast-Friesland → Dokkum 846
pe-elektra.nlPE-Elektra and InspectionsPE-Elektra and Inspections is an electrical company based in Lutjebroek that offers a variety of electrical services, including installation, repair, inspections and renovations.Electrical Engineering → Inspection 590 Technical Services → Technical 957 electricity 745 emergency 750 inspection 4279 installation 13742 repair 14576 Stede Broec → Lutjebroek 93
pedicurejudithlenis.nlPedicure salon Judith LenisThe website of Medisch Pedicure Judith Lenis presents her services as a pedicure practice in Joure and surrounding area, specializing in the treatment of various foot problems and the provision of professional pedicure care.Chronic Diseases → Diabetes 349 rheumatism 219 foot problems 320 diabetes 750 pedicure 2196 treatment 21203 De Fryske Marren → Joure 689
pedicurelemmer.nlPedicure LemmerThe website of Pedicure Lemmer presents the services of a professional pedicure practice in Lemmer and surrounding area, offering treatments both in the practice and on-site at the client's location.Specialty Medicine → Podologists 1329 foot 1929 pedicure 2196 practice 9089 collaboration 16036 De Fryske Marren → Lemmer 1188
pensionstalschraa.nlPensionstal SchraaPensionstal Schraa is a horse pension stable located in Gaasterland.Animal Husbandry → Horse Farms 174 Accommodation → Horse Stables 98 meadow 75 stable 768 horse 4337 De Fryske Marren → Balk 224
personeelsuitjeleeuwarden.nlPersoneelsuitje LeeuwardenThe website offers a range of corporate outings and staff outings in Leeuwarden and the surrounding area, with over 15 years of experience.Corporate Events → Corporate Outings 878 Tourism → City Tours 468 staff outing 17 city game 81 team outing 221 outing 982 restaurant 11215 Northeast-Friesland → Dokkum 846
picassoeethuis-lemmer.nlPicasso EethuisPicasso Eethuis is a restaurant in Lemmer that accepts online orders.International → Middle Eastern 116 Lunch → Sandwiches 466 shoarma 254 chicken 944 cheese 1205 sandwich 4098 pizza 4158 dish 5936 De Fryske Marren → Lemmer 1188
pietervandermeulen.nlSanitair & Tegels Pieter van der MeulenSanitair & Tegels Pieter van der Meulen is a tile setter and sanitary ware supplier based in Friesland, specializing in the design and installation of bathrooms and toilets.Contractors → Tiler 164 Bathroom → Sanitary Ware 845 sanitary ware 669 tile 2869 bathroom 3784 quote 12863 De Fryske Marren → Joure 689
plumkejeiers.nlBadminton Vereniging de PlûmkejeiersThe website of Badminton Vereniging de Plûmkejeiers Sint Nicolaasga serves as an information center for members and potential new members of the badminton club. It provides information about tournaments, events, news, and club activities.Sports Clubs → Table Tennis 495 Combat → Badminton 702 badminton 453 tournament 2476 club 4225 collaboration 16036 training 28133 De Fryske Marren → Sint Nicolaasga 146
pokemonmania.nlPokéManiaPokéMania is an online store specializing in Pokémon TCG cards, offering them at a competitive price with fast delivery and free shipping (from a certain amount).Card Games → Pokémon 91 pokémon cards 30 stock 1154 shopping cart 1521 ship 5103 De Fryske Marren → Bakhuizen 45
praktijksandraswart.nlPraktijk Sandra SwartThe website of Praktijk Sandra Swart offers services as a medium and magnetizer, focusing on resolving energy blockages and promoting well-being.Alternative Medicine → Energy Medicine 988 Alternative Medicine → Magnetism 44 blockage 965 medium 1293 wellbeing 2620 energy 9075 De Fryske Marren → Lemmer 1188
preparateur-pieter.nlPreparateur PieterThe website of Preparateur Pieter provides information about the preparation of found birds, including details on relevant legislation, transport declarations, and the origin of the birds. It also offers a glimpse into the Brommels festival and the open day of Vogelasiel de Fûgelhelling.Local & Regional → Regional Events 821 Environment → Nature 8454 preparation 160 demonstration 377 documentation 452 bird 922 festival 3804 De Fryske Marren → Terkaple 24
prijzenverhuisbedrijf.nlPrijzen VerhuisbedrijfThis website provides an overview of moving companies and offers price comparisons.Moving & Storage → Moving 1289 Services → Relocation 206 moving company 178 registration 4366 price 8328 Zwartewaterland → Genemuiden 405
reanimatie-westfriesland.nlStichting Reanimatieonderwijs West-Friesland e.o.The Stichting Reanimatieonderwijs West-Friesland e.o. offers readily accessible reanimation courses, without profit motive, and relies on volunteers.First Aid → Reanimation 47 citizen responder 24 cardiac arrest 75 reanimation 88 aed 490 course 14728 De Fryske Marren → Lemmer 1188
rienekefotografie.nlRieneke Fotografie en VormgevingThe website of Rieneke Fotografie en Vormgeving offers professional photography and graphic design services, with a particular focus on newborn, children’s, and school photography in the West-Friesland region of Netherlands.Family & Newborn → Individual Photography 98 printed materials 17 school photography 29 baby 1895 graphic design 2042 photography 9503 De Fryske Marren → Lemmer 1188
rijschooladam.nlRijschool AdamRijschool Adam is a driving school offering driving lessons and courses in Heerenveen, Drachten, and Joure.Online Services → Web Portals 51 driving license 402 driving lesson 712 instructor 3126 car 10865 course 14728 Smallingerland → Drachten 2052
ronhenze.nlRon Henze Mode BVThe website of Ron Henze Mode BV provides an overview of the brands it represents and specializes in the production and sale of wide-shaft boots under the brand name Jilsen, as well as web design and marketing services.E-Commerce → Webshop Development 950 Shoes → Boots 69 boots 216 webdesign 4092 webshop 8648 brand 17737 De Fryske Marren → Lemmer 1188
rotaryeenhoorn.nlRotary de EenhoornThe website of Rotary de Eenhoorn, located in Hoorn, presents the club, its activities, members, and the organization’s goals: sustainable change and social involvement.Associations → Rotary 62 rotary 78 slogan 80 club 4225 member 10154 De Fryske Marren → Lemmer 1188
rt100.nlRoundtable 100 West-frieslandThe website of Roundtable 100 West-Friesland presents the organization, its members and its service projects, which are focused on fostering mutual friendship, personal development, and contributing to the greater good.Social Organization → Men’s Organizations 32 Social Organization → Friendship Associations 30 roundtable 18 discussion 429 friendship 431 member 10154 De Fryske Marren → Lemmer 1188
rtautocenter.nlRT-AutocenterRT-Autocenter is an automotive center focused on providing affordable used cars and offering maintenance and repair services.Insurance → Home Insurance 152 Repair → Garage 1779 used cars 894 apk 1333 car 10865 blog 13392 De Fryske Marren → Sint Nicolaasga 146
rvskeukens.nlRVSkeukens.nlThe website RVSkeukens.nl offers custom-made industrial stainless steel island kitchens, focusing on luxury, hygiene, and durability. The company specializes in producing kitchens with a unique process, where the stainless steel surfaces are protected against stains and contamination.Metalworking → Milling 426 Breda → Bavel 264
schoenmakergids.nlschoenmakergids.nlThis website is a directory of shoemakers and locksmiths, organized by province in the Netherlands.Installation & Repair → Tradespeople 409 TravelContent → Travel Guides 938 shoemaker 91 province 518 locksmith 919 city 1875 Raalte → Luttenberg 532
schoonheidssalon-anneke.nlSchoonheidssalon AnnekeSchoonheidssalon Anneke offers a variety of beauty treatments focused on the well-being and beauty of its clients.Services → Wellness Services 142 aroma 59 skin 2518 salon 5541 treatment 21203 De Fryske Marren → Lemmer 1188
schoonmaakbedrijfkarsten.nlSchoonmaakbedrijf KarstenSchoonmaakbedrijf Karsten is a cleaning company providing services in West-Friesland and beyond, catering to both businesses and individuals, with a wide range of cleaning and maintenance services.Personal & Household → Household Services 1050 Context 161394 interior cleaning 42 handover 60 window cleaning 348 facade cleaning 385 cleaning 4567 De Fryske Marren → Lemmer 1188
schulpen1.nlSCHULPEN1SCHULPEN1 is a clothing store located in Lemmer, situated by the IJsselmeer and Frisian lakes, offering quality women’s and men’s clothing and providing personal styling advice.Clothing → Jeans 197 Fashion → Men’s Fashion 690 outfit 239 styling 2331 store 3901 clothing 9443 brand 17737 De Fryske Marren → Lemmer 1188
schutmachines.nlFirma SchutThe website of Firma Schut is a trading company that sells, rents, and repairs agricultural machinery, high reach forklifts, reach forks, and other machines, and supplies machines and parts in the Netherlands and sometimes abroad.Trade → Agricultural Trade 97 Agriculture → Agricultural Machinery & Equipment 631 agricultural machinery 169 part 5044 repair 14576 maintenance 20093 De Fryske Marren → Balk 224
sgtuinonderhoud.nlSG Garden MaintenanceThe website sgtuinonderhoud.nl is a company specializing in garden maintenance and landscaping, focusing on the Wognum and surrounding provinces of North Holland and South Holland.Garden Maintenance → Tree Care 660 Garden Maintenance → Gardeners 685 gardener 299 garden maintenance 462 pruning 493 landscaping 1529 De Fryske Marren → Lemmer 1188
siebegreidanus.nlSealTack B.V.The website of Siebe Greidanus provides expert advice on adhesives and sealing, aimed at businesses in the construction and industrial sectors. The platform functions as an advisory platform with a focus on recommending the right adhesive and sealant solutions.Plastics → Manufacturing 7708 Industry → Industrial 1987 adhesive 244 seal 264 Waadhoeke → Achlum 34
sieris.nlSieriS Trading & ServicesThe website of SieriS Trading & Services offers small-scale business, hobby, and storage space for rent in Wommels, with a focus on new construction and the location of the business space.Office Space → Rental Space 537 business space 130 storage space 388 unit 405 new construction 2672 De Fryske Marren → Lemmer 1188
sijmagro.nlSijm agro bvThe website of Sijm Agro BV presents a family-run business specializing in the cultivation of seed potatoes, consumption potatoes, and onions, with a focus on quality and reliability.Organic Farming → Vegetable Cultivation 116 Bakery & Food Production → Agribusiness 64 seed potato 18 onion 111 potato 542 supply 961 storage 2446 De Fryske Marren → Lemmer 1188
sjammasj.nlSjammasjThe Sjammasj website provides information about the gospel choir and combo, their rehearsals, events, and the ‘Body, Mind & Soul’ theme service.Choir → Gospel Choir 150 Theater → Performances 649 combo 59 rehearsal 1639 choir 3123 church 3439 theme 4015 event 45199 De Fryske Marren → Lemmer 1188
skarboule.nlJeu de Boules Vereniging SkarbouleThe Skarboule Jeu de Boules Vereniging is a recreational and sociable sports association based in Joure, Netherlands, dedicated to the game of Jeu de Boules.Initiatives & Collaboration → Initiatives 459 Team → Team Sports 2401 tournament 2476 association 8562 member 10154 De Fryske Marren → Joure 689
skutsjenijedei.nlSkûtsje Nije DeiThis website is a resource for information about the Skûtsje Nije Dei, a traditional Dutch sailing ship, as well as the organized competitions and activities surrounding the ship.Sailing → Traditional Sailing 19 Monuments → Heritage 526 skûtsje 57 calendar 1556 sponsorship 2686 competition 4759 event 45199 De Fryske Marren → Lemmer 1188
sloepshop.nlSloepshopSloepshop is a specialist in the sale, rental, and configuration of sloeps (small boats) and tenders, offering a wide range of models and accessories and providing personalized service, including delivery service.Boats → Sloops 129 configurator 234 delivery service 236 sloop 272 tender 329 motor 614 showroom 4883 De Fryske Marren → Joure 689
slotenmaker-heerenveen.nlSlotenmakerblijSlotenmakerblij is a locksmith company located in Heerenveen that offers various locksmith and security services, including 24-hour service, repairs, and security consultations.Repair → Lock Repair 266 Security → Burglary Prevention 176 locksmith 919 locks 953 problem 2214 security 6655 house 8121 De Fryske Marren → Balk 224
smulwereldpeter-lemmer.nlSnackbar PeterThe website of Snackbar Peter in Lemmer offers the possibility to order meals, snacks, and drinks online. The website also displays the menu and reviews.Quick Bites → Snack Bar 580 Supermarkets & Grocery → Food Stores 1058 meal 1638 fries 2753 snack 2916 sandwich 4098 drink 5191 menu 13856 De Fryske Marren → Lemmer 1188
snackbarpeterlemmer.nlSmulpunt PeterThe website of Smulpunt Peter is an online presentation of a cozy snack bar in Lemmer that offers a wide range of snacks and dishes, with the option for online ordering and delivery.Websites → Local Businesses 85 Quick Bites → Snack Bar 580 snack bar 162 fries 2753 atmosphere 5591 order 6912 menu 13856 De Fryske Marren → Lemmer 1188
snackwagentfriethoekje-lemmer.nlSnackwagen 't FriethoekjeSnackwagen 't Friethoekje is an online ordering platform for snacks and sandwiches in Lemmer.Fast Food → Fries 949 Lunch → Sandwiches 466 coleslaw 10 butter 61 rib 191 roll 358 fries 2753 sandwich 4098 De Fryske Marren → Lemmer 1188
stallinglemsterhoek.nlStalling LemsterhoekStalling Lemsterhoek is a storage facility located in Lemmer, Friesland, offering space for caravans, campers, folding campers, cars, and boats. The company provides both permanent and temporary storage solutions and is a pickup point for wood pellets.Traffic Management → Parking 508 folding camper 86 wood pellets 105 caravan 1394 storage 2446 boat 2980 security 6655 De Fryske Marren → Lemmer 1188
startpuntjoure.nlStichting StartpuntStichting Startpunt Joure provides support and space for start-ups and other businesses.Networking & Collaboration → Starting a Business 274 Office Space → Rental Space 537 office space 773 entrepreneurship 1579 contract 2415 facility 2616 space 3846 De Fryske Marren → Joure 689
stichting-refuge.nlStichting RefugeThe website of Stichting Refuge provides temporary accommodation and support for people in marital crisis to work on restoring their relationship.Social Issues → Immigration 474 refuge 10 marriage 209 france 328 prevention 1763 relationship 4205 accommodation 4921 De Fryske Marren → Lemmer 1188
stichtingpellegrina.nlStichting La PellegrinaThe website of Stichting La Pellegrina serves as a platform for financially supporting concerts and cultural events related to the La Pellegrina summer courses and Czech music, with the aim of promoting this music in the Netherlands.Ensemble → Chamber Music 466 Genres → Jazz 989 summer course 21 masterclasses 203 concert 4409 finance 5341 foundation 6678 De Fryske Marren → Balk 224
stofferinglemmer.nlStoffering LemmerStoffering Lemmer is a business that offers boat and project upholstery services, including custom work and restoration of existing interiors.Furniture → Upholstery & Fabrics 1045 Cars (Brands) → Opel 15 boat upholstery 12 upholstery 673 cushion 823 mattress 899 furniture 8751 De Fryske Marren → Lemmer 1188
stomerij1.nlstomerij1The website is a provider of laundry and dry cleaning services in various regions of the Netherlands.Cleaning Services → Laundry 256 Planning → Location Information 20 laundry 239 province 518 municipality 6837 Drimmelen → Made 335
streekkracht.nlStreekkracht psychology practiceStreekkracht psychology practice offers psychological support and coaching to adults and young people in the Heerenveen and Joure area.Specialty Medicine → Specialists 158 Medical Care & Services → Psychiatry 756 waiting time 140 insurance provider 157 diagnosis 1490 therapy 7448 practice 9089 coach 25810 De Fryske Marren → Joure 689
studio-terra.nlStudio-TerraStudio-Terra is a webshop and physical showroom offering a variety of gemstones, jewelry, spiritual products, and worldly gifts.Jewelry → Gemstones 451 spiritual products 14 amber 21 gemstone 856 jewelry 4599 showroom 4883 gift 6442 De Fryske Marren → Lemmer 1188
studiofrl.nlStudioFRLStudioFRL is a marketing and design company based in Balk offering services in the areas of design, printing, and web design.Design & Creative → Identity 593 form 679 advertising 2302 webdesign 4092 print 5511 portfolio 6854 design 27202 De Fryske Marren → Balk 224
studiomose.nlStudio MoseStudio Mose is a photographer and content creator offering professional photography, videography, and content creation services, particularly for businesses and events.Studio Services → Studio Rental 37 content creation 190 videography 427 campaign 3428 portrait 3685 photography 9503 event 45199 De Fryske Marren → Echten 54
studiostipenzo.nlStudio Stip & ZoStudio Stip & Zo is a company offering creative workshops, particularly workshops in porcelain marbling and wood burning, targeted at individuals and children in the area of Lemmer, South Friesland, and the Noordoostpolder.Crafts → Crochet 378 wood burning 15 workshop 19325 De Fryske Marren → Balk 224
taxi-eelco.nlTaxi EelcoThe Taxi Eelco website offers taxi services in and around Joure, Friesland, including regional trips, airport transfers, and online booking options.Taxi & Ride Services → Airport Transportation 365 booking form 18 taxibus 71 tariff 97 taxi 2090 region 5412 De Fryske Marren → Joure 689
taxi-joure.nlTaxi Service JoureTaxi Service Joure provides comfortable and reliable taxi and passenger transportation services in the Joure region, offering various services such as street taxi, catering taxi, healthcare transport, and more.Public Transportation → Regional Transportation 92 passenger transport 40 driver 1832 taxi 2090 rate 2606 Heerenveen → Akkrum 246
taxi2goheerenveen.nlTaxi2Go HeerenveenThe website Taxi Heerenveen eo - Taxi2Go Heerenveen provides taxi services in Heerenveen, Joure, Akkrum, Wolvega and surrounding areas, offering a range of services including general rides and specialized requests such as hospital transport and day care transport.Taxi → Airport Taxi 130 Taxi → Regional Taxis 86 ride 1075 taxi 2090 transport 6105 book 11396 Heerenveen → Akkrum 246
taxiervo.nlTaxi ErvoThe Taxi Ervo website offers taxi services to various airports in the Netherlands, emphasizing reliability, service, and competitive prices.Taxi & Ride Services → Taxi 1062 airport 789 ride 1075 taxi 2090 transportation 2851 price 8328 De Fryske Marren → Lemmer 1188
teamitreadeklif.nlBandstra-it.nlThis website provides news and updates about the 'Skutsje Frya Fresena,' a traditional Dutch sailing ship participating in races.Sailing → Traditional Sailing 19 Running → Races 266 race 1043 De Fryske Marren → Lemmer 1188
tegelhus.nlTegelhuis The website tegelhus.nl describes and promotes the ‘Tegelhuis’ in Oosterzee, a tourist attraction with a history and sights, and offers a Bed & Breakfast arrangement.AccommodationTypes → Other Accommodation 172 Travel → Tourism 3754 bed & breakfast 319 De Fryske Marren → Oosterzee 29
tennisballon.nlStichting wintertennis FranekerThe website of Stichting wintertennis Franeker provides an online booking system for tennis at a modern, sustainable tennis balloon in Franeker, North West Friesland, available from October to March.Camping → Facilities 199 Air Services → Aviation 444 ideal 249 balloon 554 court 999 date 1112 book 11396 De Fryske Marren → Lemmer 1188
themanwiththefish.nlThe Man With The FishThe website of The Man With The Fish offers the sale of fresh smoked fish, including smoked salmon in various sizes, emphasizing traditional ‘slow food’ preparation methods.Fish → Smoked Fish 39 Local & Regional Products → Local Shops 245 smoking 115 salmon 185 pickup 736 taste 933 fish 1121 De Fryske Marren → Lemmer 1188
thenakedtruth.nlThe Naked Truth ProductionsThe website of The Naked Truth, an Earring tribute band, showcases their live performances in various theaters and festivals across the Netherlands.Rock → Tribute Bands 230 Music & Performance → Music Events 758 tour guide 28 theater 2544 ticket 2785 band 2977 festival 3804 performance 7586 Oirschot → East-West-and Middle Beers 214
thewiz.nlThe Wizards of OssThis website is an online platform for former members and those interested in formatiedansen (formation dancing), specifically related to the dance group 'The Wizards of Oss'.Dance → Ballroom Dance 53 dance group 60 competition 4759 Het Hogeland → Leens 104
tinkomusbern.nlTink om us BernTink om us Bern is a platform designed to strengthen collaboration between professionals and volunteers within the Fryske Marren municipality to promote the development of youth.Youth Development → Youth 1033 youth 3126 municipality 6837 collaboration 16036
tmbdamwoude.nlTechnisch Montagebedrijf DamwoudeThe website of Technisch Montagebedrijf Damwoude presents the company as a specialist in installation technology and activities in residential and utility construction, with a particular focus on welding, heat pump installation, and the construction of technical spaces. They also offer project management and construction management services.Construction → Building Systems & Services 559 construction management 199 installation technology 223 welding 1051 heat pump 2541 project management 3423 installation 13742 Dantumadiel → Damwâld 153
toanielensa.nlToaniel and saThe website of Toaniel and sa describes a theatre group that offers improvisation classes and workshops, primarily for adults and children, and organizes children's performances and parties.Theater → Theater Groups 673 Theater → Improvisation 159 children's party 115 theatre 209 improvisation 298 workshop 19325 De Fryske Marren → Lemmer 1188
toeringmode.nlToering ModeToering Mode is a fashion store specializing in women's fashion for women aged 40 and over.Women’s Clothing → Plus Size Fashion 61 Local & Regional Products → Local Shops 245 trousers 275 fashion 2212 brand 17737 De Fryske Marren → Joure 689
tpsl.nlTennisschool Van der LecqThe website of Tennisschool Van der Lecq provides information and offers tennis lessons and tournaments for all levels.Sports Education → Sports Lessons 75 Sport Facility → Tennis 2078 racket 189 season 692 tennis 836 tournament 2476 club 4225 lesson 5154 De Fryske Marren → Lemmer 1188
trainingsstal-butemare.nlNoneThis page introduces Sjoerd Veenstra and Laurens van der Meer, two individuals involved in a horse farm in Friesland, and their background in dairy farming.Animal Husbandry → Horse Breeding 230 Livestock → Dairy Farming 671 cow 596 friesland 692 horse 4337 family 6462 De Fryske Marren → Lemmer 1188
trouw-films.nlTrouwfilmsThe website Trouwfilms offers professional wedding films, capturing the emotions and key moments of weddings with audio from the day itself and images.Videography → Wedding Videography 154 Creative → Video 777 drone 936 editing 1338 film 3007 wedding 4258 atmosphere 5591 video 6714 De Fryske Marren → Lemmer 1188
tvm-osteo.nlTom van MinderhoutThe website of Tom van Minderhout, osteopath, provides information about osteopathy and the services he offers in Ruigahuizen, Balk, and Heerenveen. The aim is to inform potential patients and help them find appropriate treatment methods for various complaints.Pain Therapy → Pain Relief 440 Physical Therapy → Osteopathy 922 function 221 osteopathy 809 movement 2304 health 6366 complaint 6479 De Fryske Marren → Balk 224
twasuskes.nlTwa SuskesThe website of Twa Suskes is a shop in Terherne, Friesland, offering sustainable men's and women's clothing, as well as unique gift items made from recycled sailcloth.Websites → Gift Shops 13 Decor & Furnishings → Home Stores 932 sailcloth 19 webdesign 4092 clothing 9443 De Fryske Marren → Terherne 98
twr-vastgoed.nlTWR vastgoedThis website advertises a country house for sale in Ter Idzard, Friesland, with a starting price of € 695,000.Apartment Living → For Sale 1007 friesland 692 view 1045 plot 1051 garage 1210 house 8121 De Fryske Marren → Balk 224
uitdekunst-timmerwerken.nlUitdekunst TimmerwerkenUitdekunst Timmerwerken is a timber company specializing in providing custom timberwork and renovation services.Wood & Timber → Timberwork 1596 Roofing → Thatch Roofing 221 timberwork 402 roof 3662 house 8121 renovation 13849 De Fryske Marren → Langweer 93
universalgym.nlUniversal Gym BalkThe website of Universal Gym Balk presents the sports club’s offerings, including fitness programs, group classes, personalized guidance, and other facilities, with the aim of attracting and enrolling visitors.Fitness → Functional Training 204 Sports → Group Class 2051 personalized guidance 20 training program 576 gym 699 group classes 1306 fitness 2251 membership 10442 De Fryske Marren → Balk 224
upperleftlabradors.nlUpper Left LabradorsThe website of Upper Left Labradors presents Labrador breeding results, breed standards, and information about breeder Noortje and her family.Breeding → Dog Breeding 109 Dogs → Breeders 556 labrador 85 pedigree 232 De Fryske Marren → Lemmer 1188
utestzelf.nlKurv B.V.U test Zelf is a webshop offering Covid-19 self-tests.Infectious Diseases → COVID-19 98 Pharmaceuticals & Medical Products → Medical Supplies 388 quantity 41 pen 210 test 769 shop 6483 order 6912 De Fryske Marren → Joure 689
vakantie-tjeukemeer.nlVeuger's VakantiewoningenThe website, Vakantie Tjeukemeer, offers holiday accommodations and activities in Friesland, with a focus on the Tjeukemeer and surrounding area, and provides information about events such as the Joure Balloon Festival.Accommodation → Villas 1018 Water Sports → Water Recreation 599 tjeukemeer 11 holiday rental 65 watersport 540 friesland 692 De Fryske Marren → Delfstrahuizen 47
vakantiehuisdewielen.nlVakantiewoning WeteringVakantiewoning Wetering offers a tranquil holiday home location on the water in the Weerribben, perfect for fishing and water sports.Vacations → Nature Vacations 269 Water Sports → Canoeing 176 bike 1541 water 2501 holiday home 2753 house 8121 garden 13129 Steenwijkerland → Kalenberg 178
vandellentechniek.nlVan Dellen TechniekThe Van Dellen Techniek website showcases a technical service provider offering installation, maintenance, and technical solutions, with a background in defense and industrial applications.Electric Vehicles → Charging Solutions 26 airbase 12 faults 27 inspection 4279 technology 6816 installation 13742 De Fryske Marren → Joure 689
vanderhouttransport.nlVan der Hout Transport B.V.The website of Van der Hout Transport Holland presents the activities of the transportation company, specializing in the transport of flowers and vegetables, primarily in the Bollenstreek and West-Friesland.Transportation Services → Refrigerated Transport 226 flower bulbs 66 bollenstreek 68 fleet 1351 transport 6105 De Fryske Marren → Lemmer 1188
vandermeerinnovation.nlVan der Meer InnovationVan der Meer Innovation is a company providing mechanical engineering advice, design of specials, construction, and restoration of American wind motors.Engineering → Mechanical Engineering 737 Agriculture → Agricultural Technology & Innovation 743 agriculture 778 restoration 3417 machine 3727 construction 7421 design 27202 De Fryske Marren → Broek 21
vanderploeg-interiors.nlVan der Ploeg InteriorsVan der Ploeg Interiors is a design and creative studio specializing in the design and creation of interiors and objects for various projects, such as schools, restaurants, and hotels.Interior Design → Interior Advice 331 Painting → Still Life 77 moodboard 135 objects 426 paintings 3907 interior 8093 design 27202 De Fryske Marren → Lemmer 1188
vanderwagtbouwtechniek.nlVan der Wagt BouwtechniekVan der Wagt Bouwtechniek is an independent construction technical advisory firm specializing in inspecting buildings and overseeing construction projects.Technology & Innovation → Construction Technology 790 Project Management → Construction Supervision 364 quality assurance 144 oversight 164 supervision 1184 inspection 4279 construction 7421 research 8967 De Fryske Marren → Joure 689
vendrighoutdesign.nlVendrig HoutdesignVendrig Houtdesign is a furniture maker and woodworker specializing in custom furniture and interior products in North Holland, Netherlands.Interior → Furniture 7454 cabinet 1730 wood 4153 furniture 8751 garden 13129 De Fryske Marren → Lemmer 1188
versmerk.nlVersMerkVersMerk is a marketing, strategy, and product development agency focused on the Agro & Food sector.Smart Home & IoT → Internet of Things 66 Research & Development → Technical Industry 37 product development 256 marketing 7107 strategy 9379 communication 10162 De Fryske Marren → Lemmer 1188
vertelman-tegelwerken.nlVertelman TegelwerkenThe website of Vertelman Tegelwerken showcases the services of a tiling company with 30 years of experience, specializing in the installation of complete bathrooms, kitchens, and toilets, as well as the repair and laying of floor tiles and natural stone floors.Renovation → Tiling 397 sanitary ware 669 tile 2869 bathroom 3784 quote 12863 De Fryske Marren → Lemmer 1188
villa-overstag.nlVilla OverstagVilla Overstag is a holiday home in Terherne, Friesland, suitable for watersport enthusiasts and nature lovers.Accommodation → Bungalows 1008 Cycling → Bicycle Rental 643 sneekermeer 14 cycling trip 41 watersport 540 holiday home 2753 terrace 4847 De Fryske Marren → Terherne 98
visualcraftsmen.nlVisual CraftsmenThe Visual Craftsmen website showcases a portfolio of diverse architectural projects, including houses, apartments, and public buildings, primarily located in the northern Netherlands.Business → Construction 72699 building 3204 architecture 3223 apartment 5088 house 8121 design 27202 Northeast-Friesland → Kollumerpomp 49
vocalroses.nlVocal RosesThe Vocal Roses website showcases a musical trio based in Oudemirdum that performs at various events and offers musical collaborations to other artists.Ensemble → Vocal Groups 225 Event Planning → Booking Agencies 77 trio 83 musician 1207 repertoire 2497 performance 7586 De Fryske Marren → Oudemirdum 73
voetbalkampfriesland.nlVoetbalkamp FrieslandThe website of Voetbalkamp Friesland is designed to inform young football players about and register them for a four-day football camp in Friesland. The event offers training sessions and the opportunity to play football in a fun atmosphere.Football → Youth Football 202 Children’s Activities → Camps 172 football camp 13 uniform 225 sponsor 1159 training 28133 event 45199 Southwest-Friesland → Koudum 134
vvdnoordoostfriesland.nlVVD Noardeast FryslânThe website of VVD Noardeast Fryslân provides information about the party, its positions, activities, candidate lists, and election programs, focusing on municipal elections in Noardeast Fryslân.Political Parties → VVD 187 Local Politics → Municipal Council 484 business climate 22 election program 85 candidate 1896 campaign 3428 region 5412 news 15293 De Fryske Marren → Sint Nicolaasga 146
vzlegal.nlVZl arbeidsrecht adviesThe website of VZL arbeidsrecht advies provides legal support in the field of labor law, aimed at both employers and employees, in cases of labor disputes, dismissal issues, and other labor law problems.Law → Social Law 267 Employment & Labor → Labor 504 labor dispute 16 reorganization 103 employment contract 122 dismissal 163 labor law 356 Drechterland → Venhuizen 154
waterlevenvijvers.nlWaterlevenThe Waterleven Joure website offers services for the design, maintenance, and renovation of ponds, with a focus on creating natural ponds that support wildlife.Ponds → Pond Maintenance 79 Context → Environment 54437 ecosystem 262 pond 686 renovation 13849 maintenance 20093 design 27202 De Fryske Marren → Joure 689
webdesignerindex.nlwebdesignerindex.nlThis website provides an index of web designers in the Netherlands, categorized by province.Office & Workspace → Business Directories 421 webdesigner 40 province 518 netherlands 1376 Pijnacker-Nootdorp → Pijnacker 788
wensjezorg.nlWens je ZorgWens je Zorg is a care institution offering household help and various forms of ambulatory care services, focusing on personalization and results.Social Services → District Nursing 60 care service 19 household help 106 personalization 455 results 3954 care 12338 De Fryske Marren → Lemmer 1188
werkendeverhalen.nlFredWerkende Verhalen is a website run by Fred who specializes in telling and creating stories for various occasions.Communication → Storytelling 297 Personal Services → Memories 103 ambition 576 story 8285 event 45199 De Fryske Marren → Broek 21
wespennest-verwijderen-heerenveen.nlBrouwer OngediertebestrijdingThe website of Brouwer Ongediertebestrijding offers services for the removal of wasp nests in various locations in Friesland, with a guarantee and professional approach.Control → Pest Control 824 wasp nest 50 wasps 181 removal 267 control 911 Weststellingwerf → Wolvega 524
westfriesekringloop.nlWestfriese KringloopThe Westfriese Kringloop is a second-hand goods shop in Zwaag, West-Friesland, which donates its proceeds to local and regional charities.Commerce → Thrift Stores 160 Retail & Commerce → Second-Hand Shops 110 charity 700 item 1125 air conditioning 2178 solar panels 4701 shop 6483 volunteer 8367 De Fryske Marren → Lemmer 1188
wijnhalla.nlWijnhallaWijnhalla is a wine shop that sells wines online and in a store in Lemmer.Gifts & Souvenirs → Wine Shops 796 Food → Supermarkets & Grocery 3568 foodpairing 14 grape 222 wine 4476 event 45199 De Fryske Marren → Lemmer 1188
woningcorporaties-gids.nlUnspecifiedThe website provides a list of housing corporations and locations where housing is available for rent in the Netherlands.Homeownership & Management → Housing Corporations 426 Context 161394 rental property 211 housing corporation 424 region 5412 Moerdijk → Zevenbergen 502
woonbootboet.nlWoonboot BoetWoonboot Boet is a website offering the rental of a luxury houseboat in Friesland, providing the opportunity to stay in a comfortable accommodation.Accommodation → Bungalows 1008 houseboat 130 surroundings 463 wifi 1372 bedroom 2051 De Fryske Marren → Sint Nicolaasga 146
woonoutletdewrede.nlWoonvoordeel de WredeWoonvoordeel de Wrede is a furniture and home accessories store.Wedding → Photo Booths 146 Decor & Furnishings → Furniture Retail 46 price guarantee 83 visitors 1048 store 3901 assortment 7799 furniture 8751 De Fryske Marren → Joure 689
wouterrutjes.nlWouter RutjesThe website is a personal website of squash player Wouter Rutjes, showcasing his sporting achievements, goals, and sponsors.Sport Facility → Golf 1441 Activity → Squash 84 squash 91 tournament 2476 goal 4974 De Fryske Marren → Joure 689
wurkwize.nlWurkwize B.V.The website Wurkwize is a recruitment agency specializing in placing personnel in various sectors, including transport & logistics, technology, construction, hospitality and manufacturing.Work → Job Search 960 Staffing & Recruitment → Extensive Services 104 recruitment agency 258 job postings 676 personnel 1084 transport 6105 technology 6816 De Fryske Marren → Joure 689
yogastudiojoure.nlYoga Studio JoureThe website of Yoga Studio Joure presents the lesson schedule, rates, and background of yoga instructor Nienke van der Grijn, and offers the possibility to book lessons and purchase subscriptions.Yoga → Yoga Studios 358 tea 1146 rate 2606 subscription 3287 yoga 3704 space 3846 lesson 5154 De Fryske Marren → Joure 689
yourglowmassagelemmer.nlYourGlowMassageLemmerThe website of YourGlowMassageLemmer presents the massage and sauna salon of Simona Nagle-Diča in Lemmer, Netherlands, and provides information on various treatment forms, including deep tissue massage, relaxation massage and maderotherapie.Massage → Massage Clinics 329 deep tissue 13 relaxation massage 71 sauna 1175 massage 7646 treatment 21203 De Fryske Marren → Lemmer 1188
zitgemak.nlZitgemakThe website, Zitgemak in Joure, offers new and almost new standing and relax chairs from various well-known brands, focusing on comfort and quality.Living & Dining → Armchairs 91 Living & Dining → Chairs 393 stock 1154 chair 1223 showroom 4883 brand 17737 Smallingerland → Drachten 2052
zussiejoure.nlZussie JoureZussie Joure is a boutique that sells clothing, bags, jewelry, and shoes.Shoes → Women’s Shoes 164 Local & Regional Products → Local Shops 245 boutique 133 bag 2399 shoes 2699 jewelry 4599 clothing 9443 De Fryske Marren → Joure 689
schoenmakerijblom.nlSchoenmakerij BlomSchoenmakerij Blom is a company in Joure that offers repair and maintenance services for shoes, clothing, bags, and leather goods.Repair → Shoe Repair 179 Safety & Security → Key Makers 96 keys 370 bag 2399 shoes 2699 clothing 9443 repair 14576 sustainability 18451 De Fryske Marren → Joure 689
pannenkoeken-thaske.nlPannenkoekenrestaurant 't HaskePannenkoekenrestaurant 't Haske is a family-run restaurant in Joure, Friesland, offering delicious pancakes and various activities for guests of all ages.Family & Themed Dining → Pancakes 49 minigolf 58 jeu de boules 117 play area 173 bowl 482 pancakes 568 De Fryske Marren → Joure 689
fietsenverhuursneek.nlBike Totaal Rodenburg SneekThe website of Bike Totaal Rodenburg Sneek is a bicycle rental company offering city bikes and electric bikes from the Gazelle brand in the area of Sneek, Joure, Lemmer and Rodenburg.Cycling → Bicycle Rental 643 sneekermeer 14 gazelle 34 bike rental 71 bicycle 2838 opening hours 2953 book 11396 De Fryske Marren → Lemmer 1188
keukenbouwer-friesland.nlBob KeukenbouwerBob Keukenbouwer is a kitchen builder based in Friesland offering kitchen designs, equipment, and countertops and providing kitchen renovation services.Kitchen → Kitchen Design 443 Renovation & Restoration → Interior Renovation 879 quooker 55 kitchen appliances 113 3d 131 countertop 179 kitchen 6443 design 27202 De Fryske Marren → Lemmer 1188
nederlandinkaarten.nlnederlandinkaarten.nlThe website nederlandinkaarten.nl offers a catalog of maps of the Netherlands, including various provinces and cities. The aim is to present a clear collection of maps for different locations.Directories → Websites 3473 TravelContent → Maps 141 keyword 280 province 518 map 801 city 1875 municipality 6837 De Fryske Marren → Broek 21
skypic.nlSkypicThe website, Skypic, offers professional photography services, including aerial, interior, and real estate photography. It caters to real estate agents, businesses, and individuals seeking high-quality visuals of properties.Commercial Work → Commercial Photography 731 Real Estate → Real Estate Photography 268 interior photography 20 aerial photography 43 visualization 621 agent 1253 real estate 4981 photography 9503 Waadhoeke → Berltsum 80
10voorhaar.nl10 voor HaarThe website of 10 voor Haar presents a hair salon in Lemmer and offers services for women, men, and children.Men’s Grooming → Barbershops 1012 Cosmetics & Aesthetic → Personal Care 1001 hair products 301 hairdresser 1372 salon 5541 De Fryske Marren → Lemmer 1188
rivla.nlRivla Timmer- & MontagewerkRivla Timmer- & Montagewerk is a handyman specializing in timber and assembly work.Wood & Timber → Timberwork 1596 Garden → Garden Wood 67 timber 353 assembly 1733 De Fryske Marren → Lemmer 1188
zwanenburghovenier.nlHovenier Rick ZwanenburgThe website of Hovenier Rick Zwanenburg offers services for garden maintenance and landscaping in the Friesland region, with a focus on the municipalities of Heerenveen, Sneek, Joure, Grou and Goingarijp.Energy & Sustainability → Green Services 263 garden maintenance 462 landscaping 1529 region 5412 garden 13129 De Fryske Marren → Goingarijp 86
vitalelements.nl4M-SpecialtiesThis website is an online shop offering a range of detailing products, with an emphasis on sustainability and recyclability.Car Care & Detailing → Detailing 941 detail 638 assortment 7799 sustainability 18451 De Fryske Marren → Oudehaske 49
jv-interieurs.nlJV InterieursJV Interieurs is a company specializing in the design, production, and installation of custom interiors for homes, workplaces, and shops.Kitchen → Custom Furniture 473 furniture maker 129 interior 8093 design 27202 De Fryske Marren → Joure 689
pelletkachelsfabriek.nlPelletkachelsfabriekThe website of Pelletkachelsfabriek is an online presentation of a showroom and webshop for pellet stoves, offering information on various brands and models.Heating → Pellet Stoves 95 pellet stove 182 showroom 4883 webshop 8648 De Fryske Marren → Lemmer 1188
borrelboard.nlBorrelboardBorrelboard is an initiative that offers drink platters featuring products from local, sustainable producers.Local & Regional Focus → Local Businesses 1077 sustainability 18451 event 45199
willemwester.nlWillem WesterThe website of Opfokstal it Pompeblêd by Willem Wester presents the facilities and services for raising horses.Equestrian → Stables 629 pasture 191 foal 204 stable 768 horse 4337 accommodation 4921 De Fryske Marren → Tjerkgaast 16
middeldorpbathmen.nlMiddeldorp BathmenThe website of Stefan Middeldorp – Middeldorp Bathmen presents the profile of Stefan Middeldorp, a specialist in water construction and steel dam walls, following the sale of his own company. The aim is to inform potential clients and project partners about his expertise and availability.Civil & Infrastructure → Hydraulic Engineering 85 Civil & Infrastructure → Waterway Construction 45 dam wall 49 water construction 81 turnover 83 communication 10162 De Fryske Marren → Joure 689
jsrcustomwheels.nlJSR Custom WheelsJSR Custom Wheels is a company based in Joure, Netherlands, specializing in custom motorcycle wheels and related services.Auto Parts & Tires → Wheels 545 spokes 10 wheel 746 restoration 3417 repair 14576 De Fryske Marren → Joure 689
bedrijfsuitjefraneker.nlStadsarrangement.nlBedrijfsuitje Franeker is a website offering a wide range of corporate outings in Franeker and surrounding cities.Corporate Events → Corporate Outings 878 team outing 221 corporate outing 388 outing 982 workshop 19325 Northeast-Friesland → Dokkum 846
saru-bouw.nlSARUBouwThe website of SARUBouw is an online portal for a construction company specializing in high-quality building and contracting services, with a focus on advice and customer satisfaction.Business & Finance → Construction Cost Management 295 contractor 1039 construction 7421 De Fryske Marren → Lemmer 1188
verdervaren.nlETAP 28iThe website advertises a quality sailing yacht, 'The Windharp', for rent.Marine & Watercraft → Watercraft 44 sailing yacht 58 rental price 102 wadden sea 170 cabin 351 insulation 2448
chaletenzo.nlChalet & ZoThe website of Chalet & Zo offers and rents chalets and a campsite in various locations, including beaches, forests, and lakes, with a focus on affordable vacations.Camping → Farm Camping 386 Accommodation → Cabins 231 walking route 340 chalet 1264 swimming pool 1664 camp 2466 vacation 4234 De Fryske Marren → Rijs 32
restaurantfriesland.nlRestaurant FrieslandRestaurant Friesland is a website designed to help users discover, review, and book restaurants in Friesland.Directories → Web Directory 53 Quick Bites → Snack Bar 580 chinese 68 pizzeria 76 friesland 692 review 1888 reservation 3373 restaurant 11215 De Fryske Marren → Joure 689
dvbioenergy.nlDijkstra AutomatiseringDijkstra Automatisering provides web design, web hosting, domain registration, and Content Management Software (CMS2) services, enabling customers to manage and expand their own websites.Domain Names → Registration 546 Technology → IT 3337 webhosting 948 domain 1811 webdesign 4092 De Fryske Marren → Sint Nicolaasga 146
eddiestuinen.nlEddie's Creative Garden IdeasThe website of Eddie's Creative Garden Ideas presents garden designs, garden maintenance, and advice, aiming to help clients create a beautiful and practical garden.Outdoor & Garden → Outdoor Living 1440 garden landscaping 31 garden design 964 plant 4509 blog 13392 renovation 13849 De Fryske Marren → Terherne 98
beston.nlBeston Prefab B.V.The website of Beston Prefab B.V. presents prefabricated concrete construction elements, including flooring panels, bulkheads, and various building components, and offers services for projects of homes and commercial buildings.Concrete & Cement → Concrete Elements 71 Design & Creative → Business Functions 211 prefab 417 customization 1723 quote 12863 Southwest-Friesland → Workum 363
pedicurejjh.nlPedicure JJHThe website of Pedicure JJH provides information about pedicure services offered in Lemmer and surrounding areas, including appointment scheduling and a description of the salon locations.Care → Personal Care 592 Personal & Household → Household Services 1050 provoet 107 pedicure 2196 salon 5541 appointment 13510 treatment 21203 De Fryske Marren → Lemmer 1188
ansichtopnederland.nlansichtopnederland.nlThe website provides an overview of places in the Netherlands.Context 161394 place 242 province 518 region 5412 Hollands Kroon → Barsingerhorn 40
miekeslotboom.nlmiekeslotboom.nlThis website documents experiences and travels with a camper, primarily focusing on Friesland and the Gaastermeer, including camping locations and descriptions of various sailing trips.Camping → Camper Travel 10 Water → Boating 1592 friesland 692 camper 1596 camp 2466 vacation 4234 travel 7210 Southwest-Friesland → Hindeloopen 127
delatexconcurrent.nlDelatexconcurrent.nlThe Delatexconcurrent.nl website offers professional latex painting services in West-Friesland and Flevoland, emphasizing quality and competitive prices for residential and commercial projects.Painting → Interior Painting 151 Interior → Wall Coverings 435 latex 195 ceiling 627 spray 658 wall 1378 paint 8747 Noordoostpolder → Emmeloord 1649
begeleidingbij-jz.nlJudit ZijlstraThe website of Judit Zijlstra offers guidance focused on self-discovery, resolving personal problems, and promoting inner balance and a carefree life, primarily through the use of the Intentie Method and trauma-informed therapy.Coaching → Personality Coaching 213 Coaching → Horse Coaching 339 self-discovery 207 trauma 2107 balance 4582 De Fryske Marren → Balk 224
kristavandijk.nlKrista van DijkThe website of Krista van Dijk presents and sells leather bags and wallets, designed and crafted by the designer herself.Crafts → Leatherworking 177 Accessories → Bags 1001 wallet 256 leather 785 gallery 1983 bag 2399 shop 6483 design 27202 De Fryske Marren → Boornzwaag 17
rvdkloet.nlN.V.The website introduces the work and life of Romke van der Kloet, a painter from Lemmer, offering insight into his artistic development and passion.Painting → Acrylic Painting 547 Personal → Personal Stories 1027 oil paint 202 drawing 1101 paint 8747 child 11566 course 14728 Amsterdam → Sloten 146
hetroodborstje.nlN.V.The website presents a holiday home named ‘Het Roodborstje’ located in Gaasterland, aimed at renting the house throughout the year.Local Communities → Villages 1005 Local Government → Village Council 479 forest 1418 holiday home 2753 terrace 4847 nature 9094 De Fryske Marren → Oudemirdum 73
meijerrioolservice.nlRioolservice MeijerThe website of Meijer Rioolservice Sint Nicolaasga presents the services of a drainage service company specializing in clearing drains and sewers in various provinces of the Netherlands.Water Management → Sewers 25 Waste Management → Sewer Cleaning 66 sewer 246 gutter 550 drain 886 drainage 1322 technique 2157 De Fryske Marren → Sint Nicolaasga 146
salome-devries.nlN/AThis website documents travels and events undertaken by Ton and Piet, particularly their anniversaries and group trips.Travel Agencies → Group Travel 207 TravelStyles → Historical Travel 13 reunion 267 anniversary 670 travel 7210 photo 7778 De Fryske Marren →  Rotsterhaule 19
hagebeukautomotive.nlHagebeuk AutomotiveHagebeuk Automotive is a specialist in the maintenance and repair of classic Mercedes-Benz and Porsche cars.Classic Cars → Mercedes-Benz 288 Medical Care & Services → Diagnostics & Testing 348 circuit 342 engine 758 diagnosis 1490 car 10865 maintenance 20093 De Fryske Marren → Echtenerbrug 24
pvmooifut.nlPersoneelsvereniging Mooi FûtThis website serves as the online platform for the 'Mooi Fût' employee association, which aims to foster camaraderie and collegiality among its members – primarily drivers and chauffeurs.News & Journalism → Politics & Government 274 Government & Administration → Government Organizations 1002 stables 212 driver 1832 board 3438 employee 4429 association 8562 De Fryske Marren → Lemmer 1188
aansneekermeer.nlWaterrijck SneekermeerThe website of Waterrijck Sneekermeer presents a new houseboat haven on the Sneekersee in Friesland, where berths are available for rent.Water → Boats 935 Hygiene & Environmental Factors → Living 546 beachclub 83 berth 341 harbor 691 boat 2980 De Fryske Marren → Goingarijp 86
moddermanverhuur.nlModderman VerhuurThe Modderman Verhuur website is a rental service offering various equipment and machinery, including items for parties, events, and construction projects, as well as beer in kegs.Gaming → Racing Games 18 tap 135 discounts 795 beer 2887 equipment 4143 rental 7257 De Fryske Marren → Echtenerbrug 24
kvisser.nlKVThe website kvisser.nl showcases photos of the town of Oudemirdum and its surroundings, including information about the local history and environment.Games → Simulation Games 18 town 126 village 808 landscape 2609 De Fryske Marren → Oudemirdum 73
vdwkozijnen.nlVDW KozijnenVDW Kozijnen is a company based in Sint Nicolaasga specializing in the manufacturing and installation of frames, doors, and windows, with a focus on sustainability and personalized service.Windows & Doors → Windows 2999 Interior → Doors 1297 window 2030 frames 2556 house 8121 De Fryske Marren → Sint Nicolaasga 146
koomenadministratie.nlKoomen Budget and AdministrationKoomen Budget and Administration is an accounting firm that supports individuals and freelancers with budget coaching, accounting, and financial guidance.Budgeting → Budget Coaching 112 budget coaching 117 finance 5341 account 5781 collaboration 16036 De Fryske Marren → Lemmer 1188
zwanenhoeve.nlLandgoed de ZwanenhoeveLandgoed de Zwanenhoeve is a sustainable holiday park in Friesland that combines sustainability and design, offering a place to experience nature.Living → Sustainable Living 817 Accommodation → Holiday Parks 1024 estate 1099 park 1863 landscape 2609 accommodation 4921 nature 9094 sustainability 18451 De Fryske Marren → Langweer 93
ruudbrock.nlRuud BrockThe website of Ruud Brock in Oudemirdum provides information about his excavation services and offers a way to contact the company.Land Development & Earthworks → Excavation Services 13 excavation 382 De Fryske Marren → Oudemirdum 73
schoonheidssalonbakhuizen.nlJettie's Schoonheidssalon BakhuizenJettie’s Schoonheidssalon Bakhuizen is a beauty salon and pedicure service provider offering a welcoming atmosphere and accessible environment.Beauty → Waxing & Hair Removal 725 Cosmetics & Aesthetic → Aesthetic Practices 202 wax 711 pedicure 2196 salon 5541 appointment 13510 De Fryske Marren → Bakhuizen 45
mollemantsje.nlSape-jan Rozema't Mollemantsje is a mollivetter (moth catcher) operating in Friesland and west Groningen, aiming to make gardens and fields free from mole damage.Nature → Insects 228 Agriculture → Livestock 2413 mole 61 field 527 friesland 692 garden 13129 De Fryske Marren → Terkaple 24
ontstoppingsbedrijf-sneek.nlOntstoppingsbedrijf SneekThe website of Ontstoppingsbedrijf Sneek offers a professional 24-hour unclogging service in Sneek and surrounding villages, with a guarantee of solving drain problems.Household & Cleaning → Home Services 1321 price quote 106 unclogging 244 drain 886 blockage 965 De Fryske Marren → Terherne 98
teamuitjesneek.nlBedrijfsuitje SneekThe website ‘Bedrijfsuitje Sneek’ offers a wide range of team building events and corporate outings in the city of Sneek and its surroundings, boasting over 15 years of experience and a quality certificate for group arrangements.Corporate Events → Corporate Outings 878 Tourism → City Tours 468 city game 81 team outing 221 corporate outing 388 hosting 3125 hospitality 3491 Northeast-Friesland → Dokkum 846
kostenfeestlocatie.nlkostenfeestlocatie.nlThe website provides an overview of event locations in the Netherlands.Brasseries & Bistros → Brasserie 1005 Travel Agencies → Online Travel Agencies 215 event location 110 compare 582 Southwest-Friesland → Wommels 113
gastouder-lemmer.nlGastouderopvang (K)Aadje PiraatjeThe website of Gastouderopvang (K)Aadje Piraatje presents a childcare provider in Lemmer, Friesland, offering care for children aged 0 to 4 years in a home-like and professional environment.Childcare → Nanny Care 301 home environment 12 childcare provider 133 law 1329 childcare 3512 child 11566 care 12338 De Fryske Marren → Lemmer 1188
auloswoodwind.nlAulos Woodwind AtelierThe website of Aulos Woodwind Atelier is a workshop specializing in the repair and maintenance of woodwind instruments, particularly clarinets and flutes, and also offers the sale of accessories and used instruments.Instrument → Wind Instruments 102 clarinet 72 flute 173 instrument 1295 accessories 12975 music 13170 repair 14576 De Fryske Marren → Lemmer 1188
neddis.nlNeddis NetworksThe website Neddis provides professional network solutions, including network equipment, Wi-Fi networks, surveillance cameras, and street connections, to businesses and individuals in Sint Nicolaasga and surrounding areas.IT → Network Management 702 router 128 switch 140 surveillance 192 wifi 1372 network 11123 De Fryske Marren → Sint Nicolaasga 146
weiwizer.nlWeiwizerThe website presents the profile of Durk Bergsma, a project and program manager with experience in area development, infrastructure, and mobility, and provides information about his services, including strategic advice and involvement in projects such as the Lelylijn Master Plan.Planning & Development → Spatial Planning 889 Civil & Infrastructure → Infrastructure 1033 masterplan 46 urban development 70 area development 219 infrastructure 1460 project management 3423 De Fryske Marren → Joure 689
witgoedservice-heerenveen.nlWitgoedservice HeerenveenThe website of Witgoedservice Heerenveen offers repair and installation services for household appliances, with a focus on providing quick and professional service in Heerenveen and surrounding areas.Household Appliances → Appliance Repair 224 malfunction 73 appliance 956 equipment 4143 warranty 4701 installation 13742 repair 14576 Heerenveen → Akkrum 246
taxivervoerinnederland.nlVervoer In NederlandThis website is a taxi search engine for the Netherlands, currently in a testing phase, allowing users to find a taxi.Taxi & Ride Services → Taxi 1062 taxi company 13 request 454 taxi 2090 transport 6105 Zwartewaterland → Genemuiden 405
frouwkjeshairfashion.nlFrouwkje's HairfashionThe website of Frouwkje’s Hairfashion presents a modern salon that focuses on personal attention and quality treatments, including cutting, coloring, styling, and hennabrows.Weddings → Bridal Salons 68 henna brows 66 hair 3014 inspiration 4081 appointment 13510 treatment 21203 De Fryske Marren → Tjerkgaast 16
vakantiewoningfriesland-boornzwaag.nlVakantiewoning Boornzwaag FrieslandThe website of Boornzwaag holiday home in Friesland presents the house as an attractive location for vacations with opportunities for water sports and relaxation in a natural environment.Italy → Lombardy 85 lake 352 watersport 540 friesland 692 cycle 1906 holiday home 2753 De Fryske Marren → Boornzwaag 17
vakantiewoning-gaasthoeke.nlN.V.This website presents a luxury holiday home in Gaasthoeke, Friesland, and provides information about the property, the surrounding area, and availability.Accommodation → Bungalows 1008 Accommodation → Bungalow Parks 931 bungalow park 81 friesland 692 holiday home 2753 De Fryske Marren → Balk 224
agramedia.nlAgraMediaThe Agrarisch Nieuwsblad aims to bridge the gap between farmers and consumers in Northern Netherlands.Local & Regional → Local News Websites 358 Farmers & Markets → Regional Agriculture 28 consumer 315 newspaper 396 farmer 661 advertisement 1707 region 5412 Smallingerland → Drachten 2052
stichtingpalla.nlSTICHTING PALLAThe Stichting Palla is a foundation dedicated to providing palliative care in North-West Friesland.Medical Care & Services → Palliative & End-Of-Life Care 1669 hospice 168 environment 4873 care 12338 collaboration 16036 De Fryske Marren → Lemmer 1188
vakantiewoningfriesland.nlVakantiewoning FrieslandThe website presents a detached holiday home in Elahuizen, Friesland, providing details about the property, activities in the area, and contact information.Accommodation → Bungalows 1008 Accommodation → Bungalow Parks 931 friesland 692 living room 1325 bedroom 2051 holiday home 2753 garden 13129 Southwest-Friesland → Hindeloopen 127
mehwphotos.nlMEHW PhotosThe MEHW Photos website showcases a portfolio of nighttime photography and landscapes, with a focus on nature, reflections, the Northern Lights, and sunsets in various locations across the Netherlands and Finland.Hotels → Inns 114 Nature & Landscape → Landscape Photography 530 tjeukemeer 11 sunset 62 cloud 1527 landscape 2609 De Fryske Marren → Delfstrahuizen 47
geschuurd.nlgeschuurd.nlThe geschuurd.nl website offers services for the renovation, sanding and finishing of hardwood floors in West-Friesland. The focus is on floor renovation, repair and applying new finishes.Flooring → Floor Restoration 15 Flooring → Hardwood Flooring 373 parquet 493 finish 747 floor 4781 renovation 13849 repair 14576 De Fryske Marren → Lemmer 1188
verandahoogeveen.nlTerrasoverkappingen B.V.The website presents a company that sells and installs terrace canopies, verandas, garden rooms and shutters.Outdoor Living → Verandas 497 verasol 14 terrace canopy 56 garden room 196 lounge 201 shutters 645 veranda 1055 Hoogeveen → Stuifzand 25
inelements.nlInElementsThe website of InElements describes services related to the adjustment (regulating) of installations, particularly air- and water-side, and the carrying out of measurements and logging for comfort and energy saving.Home Improvement → HVAC Systems 773 Installation & Repair → Ventilation 859 grille 42 measurement 731 ventilation 1110 installation 13742 Enschede → Twekkelo 14
vakantiehuisjedetapuit.nlvakantiehuisjedetapuit.nlThe website presents a holiday cottage, named ‘De Tapuit’, located in the village of Oudemirdum, adjacent to the ‘het Fonteinbos’ holiday park.Accommodation → Holiday Parks 1024 Accommodation → Bungalows 1008 holiday cottage 62 holiday park 566 bedroom 2051 garden 13129 De Fryske Marren → Oudemirdum 73
aedjoure.nlAED Joure FoundationThe AED Joure Foundation aims to make Joure heart-safe by providing AEDs and training citizens.Medical Care & Services → Emergency Response 224 Context → Community 57410 cpr 36 cardiac arrest 75 aed 490 De Fryske Marren → Joure 689
vakantiehuishemelum.nlZeilschool De MorraThe website presents 6 new, sustainable holiday homes that are being built in the village of Hemelum, Friesland, and are for sale.Local Communities → Villages 1005 Accommodation → Bungalows 1008 lake 352 holiday home 2753 home 7976 De Fryske Marren → Harich 35
stebo-tennishal.nlTennishal West-FrieslandThe Tennishal West-Friesland website provides information and booking options for tennis courts, including fixed and drop-in rentals, weekend passes, and lessons.Sport Facility → Tennis Courts 70 pass 92 tennis court 324 weekend 383 reservation 3373 rental 7257 price 8328 De Fryske Marren → Lemmer 1188
tweelgrondwerken.nlVan den Tweel GrondwerkenVan den Tweel Grondwerken is a ground excavation company providing services in Friesland, specializing in excavation work, profiling, and demolition.Land Development & Earthworks → Excavation Services 13 Land Development & Earthworks → Site Preparation 23 profiling 33 excavation 382 crane 662 demolition 1144 drainage 1322 foundation 6678 De Fryske Marren →  Sintjohannesga 24
recreatiehuisjefriesland.nlRecreatiehuisje FrieslandRecreatiehuisje Friesland is a vacation rental located in Friesland that caters to nature lovers and guests seeking relaxation. It offers holiday cottages near Vlieland and the Friesian Lakes, with opportunities to enjoy activities in the surrounding area.Accommodation → Holiday Cottages 146 Nature → Natural Area 27 tranquility 54 Terschelling → West-Terschelling 114
hoekstragroenadvies.nlHoekstra Groen AdviesHoekstra Groen Advies is a company specializing in garden design and landscaping, offering green advice and planting plans. They operate in the regions of Friesland, Groningen, Drenthe, and Flevoland.Parks → Public Park 15 Green Spaces → Green Management 96 garden design 964 plant 4509 garden 13129 De Fryske Marren → Lemmer 1188
butteruitvaartservice.nlButter UitvaartserviceButter Uitvaartservice provides post-mortem support and care, focusing on the deceased and their loved ones.Funeral Services → Funeral Arrangement 486 mourning 18 loved ones 86 funeral 2477 care 12338 Zaanstad → Zaandam 2740
wellingtransport.nlWellingtransportWellingtransport is a company offering transport, maintenance, repair, and truck styling services.Freight & Logistics → Truck Transportation 13 Freight & Logistics → Trucks 899 fleet 1351 truck 1412 transport 6105 repair 14576 maintenance 20093 De Fryske Marren → Joure 689
wefixfinance.nlWeFix Finance LemmerWeFix Finance Lemmer is an accounting and administration office that assists entrepreneurs with accounting, tax advice, and business advice.Accounting → General Accounting 939 Government & Legal → Tax 1322 business advice 179 financial 855 tax advice 1522 account 5781 administration 6587 De Fryske Marren → Lemmer 1188
glazenwasserjoure.nlVOF Mulder SchoonmaakThe website of VOF Mulder Schoonmaak presents and promotes the services of a window cleaning and cleaning company, with a focus on the Joure and surrounding area.Cleaning Services → Exterior Cleaning 20 window cleaning 348 gutter 550 facade 1490 office 2898 cleaning 4567 floor 4781 Heerenveen → Akkrum 246
doriensschoonheidssalon.nlDorien's SchoonheidssalonDorien's Schoonheidssalon is a beauty salon offering various transformation treatments and relaxing services aimed at improving skin and client well-being.Cosmetics & Aesthetic → Home Health 68 skin analysis 361 mask 381 facial 424 eyebrows 1127 massage 7646 De Fryske Marren → Oosterzee 29
debolleboelboxen.nlDe BolleBoelDe Bolle Boel is a website offering themed and toy boxes to encourage children to play and craft.Hobbies → Creative Hobbies 412 Early Childhood Education → Play 44 craft 538 play 631 box 1982 child 11566 Aa en Hunze → Rolde 176
reinouw.nlReinouwReinouw is a website focused on increasing employee happiness and productivity in companies, offering services related to onboarding, development, and offboarding of employees.Human Resources → Employee Development 762 employee happiness 24 onboarding 78 productivity 496 conflict 1290 employee 4429 De Fryske Marren → Balk 224
stamgenealogie.nlStam GenealogieThis website provides an online genealogy database tracing the lineage of the Stam family, focusing on the ancestors of Colin & Julyan Stam.Social Sciences → Genealogy & Family History 1403 Events → Places 1219 dna test 21 ancestor 107 genealogy 543 document 1678 family 6462 De Fryske Marren → Lemmer 1188
stretchtentonline.nlStretchTentOnline.nlThe website Stretchtent Online offers a range of stretch tents and sailcloth tents for various events and parties.Garden → Shelter 57 stretch tent 74 tent 1328 quote 12863 event 45199 De Fryske Marren → Balk 224
blauwlichten.nlblauwlichten.nlThis website presents a list of fire departments (Brandweerkorpsen) in the Netherlands.Emergency Services → Fire Department 138 netherlands 1376 Hof van Twente → Diepenheim 200
stottercentrumfriesland.nlStottercentrum FrieslandStottercentrum Friesland is a center that provides specialized stutter therapy for children and adults.Organizations → Professional Associations 1004 stutter therapy 15 fee 640 practice 9089 child 11566 treatment 21203 De Fryske Marren → Joure 689
stallinghoman.nlStalling HomanThe website of Stalling Homan offers storage and parking services for various vehicles and recreational equipment in Friesland.Caravans → Caravan Storage 145 Logistics → Storage 1170 friesland 692 caravan 1394 camper 1596 parking 1928 storage 2446 boat 2980 De Fryske Marren → Boornzwaag 17
praw.nlPRAWThe website of PRAW offers audio support and technical solutions for image and sound, provided by Frits Barendsen, an audio engineer with diverse backgrounds.Audio → Sound Technology 168 Event Resources → Event Technology 259 recordings 172 audio 934 sound 1649 image 2605 technology 6816 event 45199 De Fryske Marren → Echten 54
bbas.nlBoerhof Bouw & Auto ServiceThe website of Boerhof Bouw & Auto Service offers stair construction and installation services to individuals.Construction & Renovation → Staircases 329 Renovation & Restoration → Interior Renovation 879 measurement 731 stair 815 wishes 2717 installation 13742 design 27202
glazenwasserwolvega.nlVOF Mulder SchoonmaakThe website of VOF Mulder Schoonmaak presents and promotes its window cleaning and cleaning services, with a focus on Wolvega and surrounding areas. The company offers a wide range of cleaning services and emphasizes safety, reliability, and a personalized approach.Maintenance & Services → Glass Maintenance 371 Design & Projects → Self-Employed Entrepreneurs 505 window cleaning 348 gutter 550 facade 1490 office 2898 cleaning 4567 solar panels 4701 Heerenveen → Akkrum 246
witgoedservice-zuidwest-friesland.nlWitgoedservice FrieslandWitgoedservice Friesland offers direct appliance repair services to individuals in Friesland.Household Appliances → Washing Machines 195 Repair → Mobile Phone Repair 1012 issue 214 appliance 956 diagnosis 1490 repair 14576 brand 17737 Dantumadiel → Veenwouden 73
mondhygienefriesland.nlMondhygiëne FrieslandThe website of Mondhygiëne Friesland provides information and allows appointments to be scheduled for dental hygiene treatments, emphasizing personalized attention and the option of home dental care.Dentistry → Oral Hygiene 750 dental hygienist 522 appointment 13510 treatment 21203 Southwest-Friesland → Koudum 134
gaasterlandbos.nlVakantieverblijf GaasterlandVakantieverblijf Gaasterland is a cozy holiday accommodation located in the Rijsterbos, in Southwest Friesland, offering peace and quiet and various activities and facilities.Accommodation → Bungalow Parks 931 Nature → Forest 387 holiday accommodation 56 forest 1418 campsite 2093 accommodation 4921 nature 9094 Southwest-Friesland → Workum 363
dammenstratenmakers.nlDammen StratenmakersDammen Stratenmakers is a company specializing in paving, landscaping, and the installation of retaining walls and decks in Hoorn and surrounding areas.Garden → Paving 1003 Landscaping → Garden Installation 617 garden tiles 29 decorative paving 39 retaining walls 64 deck 268 landscaping 1529 paving 1942 De Fryske Marren → Lemmer 1188
suitsdriveby.nlSuits Drive BySuits Drive by is a company specializing in renting tuxedos and formal attire in Nijmegen and the surrounding area.Rental → Clothing Rental 20 Clothing → Suits 159 tuxedo 27 shoes 2699 account 5781 book 11396 De Fryske Marren → Lemmer 1188
kammingamultiline.nlKamminga MultilineThe Kamminga Multiline website showcases the company’s services related to professional road marking, with particular focus on zebra crossings and traffic symbols.Road Traffic → Road Marking 16 road marking 22 De Fryske Marren → Joure 689
bouwservice-friesland.nlBouwservice FrieslandBouwservice Friesland is a construction company specializing in new construction, renovation, and carpentry, with a focus on personal service and craftsmanship.Building & Materials → Carpentry & Joinery 830 Renovation & Restoration → Construction Industry 499 carpentry 2218 construction 7421 renovation 13849 De Fryske Marren → Joure 689
vakantievillaopmaat.nlNatuurhuisjes.nlThe website offers holiday homes in nature with the option for contactless stays.Accommodation → Group Accommodation 844 Accommodation → Bungalow Parks 931 stay 702 tree 1879 holiday home 2753 nature 9094 Northeast-Friesland → Ljussens 14
humsteeholidays.nlHumstee HolidaysThe website offers luxurious holiday accommodations in Friesland, specifically beach villas and dune villas in Makkum and harbor houses in Heeg, catering to water sports enthusiasts and guests seeking relaxation and the Friesian landscape.Accommodation → Villas 1018 Water Sports → Water Sports Clubs 29 watersport 540 friesland 692 villa 1351 beach 3210 Southwest-Friesland → Heeg 227
dierenpension-immermoed.nlDierenpension ImmermoedThe website of Dierenpension Immermoed provides information about a pet pension offering vacation and daycare for dogs and cats, located in Harich, Friesland.Animals → Animal Welfare 1372 Tourism → Holidays 1086 pet pension 10 kennel 513 daycare 1365 pet 1617 vacation 4234 De Fryske Marren → Lemmer 1188
daalenenpieken.nlVan Daalen & PiekenVan Daalen & Pieken offers group hiking tours, aimed at self-discovery and connection with nature and other travelers.Hiking → Mountain Hiking 31 Hiking → Trekking 95 hut 117 traveler 180 hiking 841 nature 9094 North-Holland → Bergen 2009
tuin-coachsieger.nlTuincoach SiegerTuincoach Sieger provides garden maintenance, design advice, and personalized service in North-West Friesland.Garden Maintenance → Landscapers 287 Design & Projects → Self-Employed Entrepreneurs 505 passion 792 region 5412 garden 13129 maintenance 20093 design 27202 Waadhoeke → Franeker 694
hettingabeverages.nlHettinga BeveragesHettinga Beverages is a bottling company specializing in bottling, filling, and producing small to medium-sized batches of beverages.Food & Beverage → Food Industry 835 Business Services → Business Activities 230 filling 121 bottle 300 beverage 586 drink 5191 De Fryske Marren → Joure 689
oktoberfestsintnyk.nlOktoberfest Sint Nyk & Jeugdsociëteit De WisselThe website of Oktoberfest Sint Nyk provides information about the event, including edition details, contact information, ticket sales, and the opportunity to purchase Oktoberfest clothing.Festivals → Beer Festivals 175 Visual Arts → Folk Art 30 dirndl 16 lederhosen 19 oktoberfest 74 dj 1722 De Fryske Marren → Sint Nicolaasga 146
klavermetaalbewerking.nlKlaver metalworkingThe website of Klaver metalworking presents the services of a company specializing in turning and milling work, metalworking, and welding.Metalworking → Turning 66 Metalworking → Milling 426 turn 226 milling 275 cnc 305 metalworking 565 plastic 1232 De Fryske Marren → Joure 689
bijbelonderwijsenpastoraat.nlFoundationThis website provides information about the activities of the foundation, specifically concerning biblical instruction and pastoral guidance, and offers an account of the use of resources.Protestantism → Reformed 1323 Protestantism → Churches 1009 study 720 church 3439 wordpress 3551 Noordenveld → Roderesch 23
dijkveldstol.nlMelkveebedrijf Dijkveld StolMelkveebedrijf Dijkveld Stol is a dairy farm located in the Noordoostpolder region focused on modern milk production.Livestock → Dairy Farming 671 dairy farm 129 milk 421 polder 476 technique 2157 De Fryske Marren → Lemmer 1188
onderwijsbureaujelle.nlOnderwijsbureau JelleOnderwijsbureau Jelle provides educational guidance, research, and analysis to schools, research institutions, and companies.Leadership & Teamwork → Personality 777 Business & Management → Educational Consulting 561 analysis 1615 research 8967 education 13471 workshop 19325 De Fryske Marren →  Rotsterhaule 19
johangootjes.nlJohan Gootjes pianolespraktijkThe website is for Johan Gootjes' piano lesson practice, offering lessons in Wervershoof for all ages.Music Education → Piano Lessons 317 music theory 62 conservatory 237 piano lessons 346 rate 2606 practice 9089 collaboration 16036 De Fryske Marren → Lemmer 1188
bertdriessen.nlBD Management & ConsultancyThe website of BD Management & Consultancy showcases expertise in management and consultancy services, with a focus on education, healthcare and other professional organizations.Management → Quality Management 909 Business & Management → Educational Management 375 interim 732 change 2580 Meierijstad → Veghel 1288
innotechcon.nlInnotechconInnotechcon is a company specializing in repair and maintenance services for ships.Engineering → Marine Engineering 102 Marine & Watercraft → Ship Repair 51 ship 5103 repair 14576 De Fryske Marren → Lemmer 1188
thebluebandits.nlThe Blue BanditsThe website of The Blue Bandits showcases a sixties band with members from West Friesland, who perform music from the 1960s and 70s and announce upcoming performances.Rock → Garage Rock 12 Rock → Roll 43 repertoire 2497 band 2977 performance 7586 music 13170 Drechterland → Venhuizen 154
jelmerfotografie.nlJelmer FotografieThe website of Jelmer Fotografie showcases a portfolio of photographs covering various themes, including sports, nature, product photography, and architecture.Nature & Landscape → Nature Photography 482 landscape 2609 architecture 3223 vehicle 3743 sport 4228 photography 9503 Leeuwarden → Grou 366
teambalk.nlTeam BalkTeam Balk is a company that provides stage and stand construction services for events both domestically and internationally.Design & Creative → Business Functions 211 Business & Professional → Trade Shows 951 trade show 99 stand 294 crew 320 stage 758 festival 3804 event 45199 De Fryske Marren → Balk 224
willyoldtimers.nlWilly OldtimersThe website of Willy Oldtimers showcases a collection of Mercedes Heckflosse and Ponton classic cars that he collects and occasionally offers for sale.Classic Cars → Mercedes-Benz 288 classic car 404 auction 561 De Fryske Marren → Sondel 14
betaalbaarwonenvooriedereen.nlBetaalbaarWonen BVBetaalbaarWonen BV develops and builds sustainable, energy-efficient homes, particularly the ‘Coupé’, to promote affordable housing for starters.House Types → Houses 2546 Construction Industry & Methods → Sustainable Construction 1391 modular 160 home 7976 energy 9075 sustainability 18451 De Fryske Marren → Lemmer 1188
vlotts.nlVlot Technical ServicesThe website of Vlot Technical Services offers mobile welding services, specifically MIG, MAG and TIG welding, on-site throughout the Netherlands. The company focuses on projects of all types, including certified welding work.Event Services → Mobile Services 37 welding 1051 certification 3380 De Fryske Marren → Lemmer 1188
vvewesterbergen.nlVereniging van Eigenaren WesterbergenThe website of the Vereniging van Eigenaren Westerbergen provides information about Vakantiepark Westerbegen and is primarily intended for members and interested parties.Accommodation → Holiday Parks 1024 Associations & Groups → Associations 2267 surroundings 463 park 1863 board 3438 association 8562 member 10154 De Fryske Marren → Echten 54
stratenmakersbedrijfkaspers.nlStratenmakersbedrijf KaspersStratenmakersbedrijf Kaspers is a company that offers various services related to paving, groundwork, and landscaping, primarily in the province of Friesland.Garden → Paving 1003 shed 630 groundwork 1348 landscaping 1529 fence 1814 paving 1942 care 12338 Southwest-Friesland → Bolsward 566
hartyachting.nlHart YachtingHart Yachting is a yacht yard offering winter storage, service, and sales of sloep boats.Marine & Watercraft → Boat Sales 144 Marine & Watercraft → Yachts 189 winter storage 182 yacht 647 boat 2980 sale 5930 Southwest-Friesland → Koudum 134
fit-pt.nlFit PTFit PT is a personal training studio located in Drachten and Joure that offers personalized guidance and training sessions.Fitness → CrossFit 282 Fitness → Fitness Studios 354 group training 270 nutrition 4935 health 6366 training 28133 Smallingerland → Drachten 2052
heribouw.nlHeri BouwThe website of Heri Bouw is an online presentation of a one-man construction company specializing in masonry, plastering, adhesive work and pointing work, both for new construction and renovation projects. The company offers project management and execution services as well as the hiring of a foreman/executor.Sustainable Building → Construction Projects 823 execution 426 masonry 460 plaster 2175 project management 3423 quote 12863 renovation 13849 Westerkwartier → Zuidhorn 286
milieustraat-joure.nlMilieustraat SneekThe website provides information about the Milieustraat (recycling center) in Sneek, near Joure, detailing opening hours, accepted waste types, and advantages over municipal recycling centers.Waste Management → Recycling Centers 15 Planning → Local Travel 22 recycling center 20 waste 1312 opening hours 2953 Southwest-Friesland → Sneek 1921
beunkdekleine.nlBeunk - de Kleine VistripsBeunk - de Kleine Vistrips is a website dedicated to an annual fishing competition and the stories of members of the Beunk and de Kleine families during their fishing trips.Water Activity → Fishing 1055 Culture → Traditional Practices 371 fisherman 26 trophy 145 fish 1121 trip 2032 hotel 3543 De Fryske Marren → Goingarijp 86
lactatiekundigemarije.nlLactatiekundige Marije Woortman - van der GlasThe website of Lactation Consultant Marije Woortman - van der Glas offers professional advice and support regarding breastfeeding, primarily focused on women and partners in Lemmer and Southwest Friesland.Pediatric & Child Health → Breastfeeding 212 Nursing & Support → Nursing 536 health insurance 287 breastfeeding 398 hospital 560 education 13471 De Fryske Marren → Lemmer 1188
donkerlicht.nlDonkerlichtThis website is a portfolio of dog photography and reports on natural events in the Netherlands, with a focus on birds and landscapes.Ornithology → Bird Conservation 170 Nature & Landscape → Landscape Photography 530 winter 333 bird 922 landscape 2609 dog 5483 nature 9094 photography 9503 De Fryske Marren → Lemmer 1188
fredfotografie.nlFred FotografieThis website showcases the work of nature enthusiast and photographer Fred Weel, primarily his photos of nature in the West-Friesland region.Nature → Fauna 74 mammal 33 polder 476 guide 1364 nature 9094 photography 9503 De Fryske Marren → Lemmer 1188
dirkmaatdesign.nlDirkmaat DesignDirkmaatDesign is a company specializing in painting, wallpapering, and microcement applications, primarily focused on renovations and restorations in the North Holland region.Interior → Wall Coverings 435 Interior → Wall Finishing 314 microcement 57 spray 658 wallpaper 1756 paint 8747 renovation 13849 De Fryske Marren → Lemmer 1188
elkawebshop.nlElka GrootkeukentechniekElka Webshop is a webshop that supplies large kitchen equipment and catering technology.Household Appliances → White Goods 132 Technical Components → Technical Equipment 32 refrigeration 213 dishwasher 324 supplier 1725 coffee 3838 equipment 4143 brand 17737 De Fryske Marren → Echten 54
heij-tec.nlHeij-Tec LemmerHeij-Tec is a company providing IT services, primarily to SMEs and individuals in the Lemmer region.Automation & Control → Automation 1494 Computer → Computer Support 1003 sme 466 electronics 971 computer 1969 automation 2682 repair 14576 maintenance 20093 De Fryske Marren → Lemmer 1188
fryslan-foto.nlWilliam Wissink FotografieThe website fryslan-foto.nl presents photographs taken by William Wissink in the province of Friesland, organized by geographical area and municipality.Nature & Landscape → Landscape Photography 530 Painting → Landscape Painting 186 friesland 692 landscape 2609 municipality 6837 photo 7778 photography 9503 De Fryske Marren → Joure 689
goedkoopste-zonnepanelen.nlZonnepaneelhandel B.V.This website provides information about solar panels and related services such as financing, insurance, and subsidies.Loans & Credit → Other Loans 22 loan 832 subsidy 2649 solar panels 4701 insurance 6359 energy 9075 Noordenveld → Roden 621
anbiance.nlStudio AnbianceStudio Anbiance provides personalized interior design and advice aimed at making people feel at home.Interior Design → Interior Consulting 615 interior design 1802 space 3846 atmosphere 5591 De Fryske Marren → Lemmer 1188
watervilla-langelille.nlRoompot VakantiesThe Watervilla Langelille website presents a recreational home in Langelille, Friesland, situated on navigable waters, focused on vacation enjoyment and offering a ‘wow factor’ through luxury and comfort, with opportunities for watersports and relaxation.Accommodation → Villas 1018 Entertainment → Leisure Activities 338 sauna 1175 water 2501 vacation 4234 house 8121 garden 13129 Steenwijkerland → Kalenberg 178
dekreftcoach.nlDe Krêftcoach PTDe Krêftcoach PT is a personal trainer based in Joure, offering individual training and coaching to help clients achieve their fitness goals.Artists → Studios 152 Fitness → Fitness Studios 354 trainer 1966 goal 4974 studio 5465 blog 13392 De Fryske Marren → Joure 689
semdelange.nlSem de LangeThe website of Sem de Lange presents his career as a motocross racer, focusing on his achievements, race schedule, sponsorship, and recent news updates.Motorsport → Motocross 141 motocross 52 achievement 58 race 1043 sponsorship 2686 news 15293 De Fryske Marren → Lemmer 1188
elamare.nlElamareThe website offers vacation home rentals in Friesland, specifically focusing on the vacation house Elamare located on the Fluessen lake near Elahuizen.Italy → Lombardy 85 vacation house 135 lake 352 friesland 692 recreation 799 garden 13129 De Fryske Marren → Balk 224
youngidentity.nlYoung IdentityThe website Young Identity offers professional guidance to children, parents, and schools regarding behavior and development, focusing on social-emotional development, identity, anxiety, and bullying.Support → School Support 171 Law → Family 2909 identity 1028 parent 4318 school 7856 child 11566 De Fryske Marren → Lemmer 1188
lydiabeauty.nlLydia BeautyLydia Beauty is a salon in Lemmer offering various services including haircuts, makeup, facials, nail styling, and the sale of products.Health → Cosmetics & Aesthetic 4579 nail studio 251 makeup 1477 hair 3014 salon 5541 treatment 21203 De Fryske Marren → Lemmer 1188
rodericklagendijk.nlAcupuncture Drachten – Roderick LagendijkThe website of Acupuncture Drachten – Roderick Lagendijk offers acupuncture treatments in Drachten, focused on resolving physical ailments by stimulating the body’s self-healing capabilities.Emergency & Safety → Alternative Healthcare 567 physical ailments 25 qi 116 holistic 699 acupuncture 1537 therapy 7448 treatment 21203 Smallingerland → Drachten 2052
tijnkramer.nlTijn KramerThis website features travel photos and reflections from the author, Tijn Kramer, about his travels and experiences.Asia → India 23 Travel Stories → Personal Travel Stories 77 india 68 friesland 692 travel 7210 De Fryske Marren → Joure 689
hoveniersbedrijfweltevree.nlHoveniersbedrijf WeltevreeHoveniersbedrijf Weltevree is a landscaping company specializing in garden maintenance, ranging from garden design and construction to ground work and property boundaries.Garden → Fences 824 Environment → Environmental Technology 712 property boundary 10 garden maintenance 462 garden design 964 groundwork 1348 portfolio 6854 De Fryske Marren → Echtenerbrug 24
cleaningcontrol.nlCleaning ControlThe website of Cleaning Control is a facility management advisory firm specializing in objectively measuring the quality of cleaning services, contract management, and workplace advice.Commercial Law → Contract Law 339 Construction & Maintenance → Procurement 567 contract management 210 objective 415 inspection 4279 cleaning 4567 De Fryske Marren → Lemmer 1188
thuisbegeleidingwestfriesland.nlThuisbegeleiding WestfrieslandThuisbegeleiding West-Friesland provides individual support to PGB holders in West-Friesland, offering assistance within their own homes.Support → Personal Support 360 pgb 197 structure 1305 care 12338 De Fryske Marren → Lemmer 1188
decabriodealer.nlHandelsonderneming BraakmanDe Cabrio Dealer is a car dealership specializing in the sale of convertibles in West Friesland.Cars → Convertibles 20 Essential → Home 70708 convertible 33 west-friesland 41 used cars 894 brand 17737 Drechterland → Wijdenes 46
startbijbart.nlStart bij BartStart bij Bart is a guidance agency that provides support to children and young people with behavioral problems, offering assistance in various settings, including home, school, and a farm.Social Organization → Child Welfare 1147 Support → School Support 171 situation 655 problem 2214 farm 2622 parent 4318 child 11566 De Fryske Marren → Lemmer 1188
rentatentnederland.nlRent a Tent NederlandRent a Tent Nederland is a website that provides an overview of camping locations in the Netherlands where you can rent a tent and book camping holidays.Event Rental → Tent Rental 437 nature area 497 island 780 tent 1328 campsite 2093 holiday 2295 Ede → Otterlo 371
thinkalike.nlTHINKALIKE R&D EN SOFTWARE OPLOSSINGENThe website of THINKALIKE R&D EN SOFTWARE OPLOSSINGEN describes a company that develops and implements commercial and technical solutions, with a focus on web applications, CMS solutions, and training programs.Programming Languages → PHP 400 Business Services → Business Activities 230 php 282 web application 609 cms 613 training 28133 De Fryske Marren → Lemmer 1188
atcwestfriesland.nlTrigoon scholengemeenschap West-FrieslandThe Arbeids Training Centrum (ATC) is a training center that prepares students from various schools and institutions for internships and employment through vocational skills training.Educational Support → Student Guidance 134 mentor 529 internship 694 certification 3380 student 7623 De Fryske Marren → Lemmer 1188
helingvoordeziel.nlHeling voor de ZielThe website of Heling voor de Ziel provides information and therapies based on Malva therapy, aimed at stimulating the body’s self-healing ability and improving well-being.Alternative Medicine → Energy Medicine 988 Alternative Medicine → Holistic 1153 aura 109 meridian 193 chakra 278 stone 724 De Fryske Marren → Lemmer 1188
handelsondernemingfolkerts.nlHandelsonderneming FolkertsHandelsonderneming Folkerts is a company that provides various jobs and services in and around homes and businesses.Windows → Glass Installation 117 Garden → Decking 44 cladding 115 frames 2556 glass 2919 paint 8747 renovation 13849 De Fryske Marren → Balk 224
verlaatsweg.nlShine-ontharenThe website Verlaatsweg.nl provides information about the road De Verlaatsweg located in Koggenland, North Holland.Lifestyle → Travel 42912 shine 50 ice rink 265 festival 3804 De Fryske Marren → Lemmer 1188
buurtvereniging-de-zandbanken.nlBuurtvereniging de ZandbankenThe website of Buurtvereniging de Zandbanken provides information about the activities, events, and facilities of the neighborhood association, with a focus on social connections and recreation for members and residents of Lemmer.Neighborhood Focus → Community Centers 941 Community & Social → Social Events 416 neighborhood house 10 game 2807 member 10154 event 45199 De Fryske Marren → Lemmer 1188
t-w-f.nlTimmerbedrijf West-FrieslandTimmerbedrijf West-Friesland is a carpentry business focused on serving both private and professional clients, specializing in renovations and projects.Renovation → Facade Renovation 279 window frames 224 crane 662 rental 7257 renovation 13849 De Fryske Marren → Lemmer 1188
peties.nlPetraThis website presents Petra, a childcare provider in Joure, Friesland, offering care for children aged 0 to 4 years.Early Years → Childcare 6029 friesland 692 childcare 3512 family 6462 child 11566 De Fryske Marren → Joure 689
vexonsecurity.nlVexon SecurityThe website of Vexon Security presents security services to private and public organizations in Friesland and North Netherlands, with a focus on events, hospitality, and crowd management.Event Support & Services → Event Security 64 Security & Surveillance → Security 3251 crowd management 18 hostess 165 hospitality 3491 security 6655 event 45199 Southwest-Friesland → Sneek 1921
heerschapbier.nlHeerschap Bar-BierThe website of Heerschap Bar-Bier presents the craft beers brewed by a barbershop from Joure, focusing on their Tripel and Skearskom, and offers the possibility to order online.Beer → Specialty Beer 113 tripel 14 barbershop 512 beer 2887 De Fryske Marren → Joure 689
aandachtbijschuld.nlAandacht Bij SchuldAandacht Bij Schuld is a bureau that provides financial assistance and support to people facing financial difficulties and debt problems.Financial Assistance → Debt Support 76 Social Services → Community Support 179 budgeting coaching 14 financial difficulties 26 care institution 64 guardianship 767 administration 6587 De Fryske Marren → Joure 689
hooxies.nlAuke HoekstraThe website documents travels in Friesland, Netherlands, focusing on the local environment, nature and culinary experiences. It also includes personal updates and news about Auke Hoekstra’s academic achievements and diploma ceremony.Recordings & Media → Singers 844 Personal → Biography 1003 celebration 316 friesland 692 diploma 795 travel 7210 nature 9094 De Fryske Marren → Lemmer 1188
boeken.huisboten.nlVaarHuis Groep B.V.Huisboothuren.nl is a website specializing in the rental of houseboats in Friesland, Netherlands.Water Recreation → Houseboats 36 AccommodationTypes → Accommodation 12130 sneekermeer 14 houseboat 130 arrangement 3104 terrace 4847 Heerenveen → Akkrum 246
bnbdevliegenzwam.nlBnB de VliegenzwamBnB de Vliegenzwam is a bed & breakfast located in Oostwoud, West-Friesland, Netherlands, offering guests a peaceful setting and access to nature and cities.Accommodation → Beds 228 Landscape → Polders 212 steam train 14 tulip fields 25 dwelling 118 nature area 497 accommodation 4921 apartment 5088 Medemblik → Oostwoud 41
hcgauwtevreden.mijnhengelsportvereniging.nlHc Gauw TevredenThe website of Hc Gauw Tevreden provides information about this fishing club, including events, competitions, news, and governance details.Fishing → Fishing Clubs 190 fishing club 20 board 3438 competition 4759 member 10154 event 45199 De Fryske Marren → Lemmer 1188
werkenbij.anicura.nlAniCura NetherlandsThe website, Work at AniCura Netherlands, is a job board offering various positions within the veterinary sector, including veterinarians, veterinary technicians, and support/management roles. The aim is to inform potential employees about open positions and facilitate the application process.Animals → Veterinarians 813 veterinarian 864 work 3122 vacancy 6598 Hoorn → Zwaag 494
aliessmid.nlPraktijk voor haptotherapie en psychologie Alies SmidThe website presents a practice offering haptotherapy and psychology services to adults, children, and adolescents, including coaching, relationship counseling, and supervision.Coaching → Relationship Coaching 558 Therapy → Haptotherapy 633 haptotherapy 444 self-awareness 751 psychology 777 connection 4007 relationship 4205 coach 25810
nl.missdaisy.nlMissDaisy.nlMissDaisy.nl is a mobile cocktail bar that provides cocktails and drinks on location, such as at offices, weddings, or events. They also offer cocktail workshops and event photography services.Wedding → Photo Booths 146 Events & Hospitality → Event Services 319 video booth 18 cocktail bar 62 dj 1722 catering 6456 photography 9503 workshop 19325 De Fryske Marren → Lemmer 1188
vandersluis-lentelink.praktijkinfo.nlHuisartsenpraktijk van der Sluis – LentelinkThe website of Huisartsenpraktijk van der Sluis – Lentelink provides information about the practice, opening hours, staff, and various health-related topics and services.Reference → Information Resources 352 Medical Care & Services → Primary Care 5699 prescription 859 staff 3405 health 6366 practice 9089 appointment 13510 De Fryske Marren → Sint Nicolaasga 146
martinus.veldzijdewind.nlMartinusparochie ‘t VeldThe website of the Martinusparochie in ‘t Veld provides current information about the parish, including services, parish news, archives, and photos. It serves as an information resource for the parish community and visitors.Reformed → Church Organization 155 Local Communities → Villages 1005 parish 353 photo 7778 De Fryske Marren → Lemmer 1188
solsports.jouwweb.nlSOL Sports & EventsThe website of SOL Sports & Events presents the activities of the company, primarily related to volleyball, including events, training, courses, sports equipment and a beach volleyball holiday.Team Sports → Volleyball 842 Apparel → Sporting Goods 1374 health products 36 sports equipment 164 volleyball 617 training 28133 event 45199 Southwest-Friesland → Sneek 1921
landingspagina.boereiis.nlIJsboerderij BoereiisThe website of IJsboerderij Boereiis presents a farm in Friesland that sells ice cream, offers children’s parties, and where visitors can play for free.Parties → Birthday Parties 1008 Agricultural Tourism → Agricultural Recreation 105 ice cream farm 11 children’s party 128 cow 596 ice cream 1000 playground 1088 farm 2622 Heerenveen → Akkrum 246
zuyderzeelyceum-lemmer.vario-onderwijsgroep.nlZuyderzee Lyceum LemmerThe website of Zuyderzee Lyceum Lemmer presents information about the secondary education that the school in Lemmer offers, including information on programs, activities, contact details and school documents.Secondary Education → VMBO 332 Secondary Education → VWO 48 document 1678 student 7623 school 7856 education 13471 De Fryske Marren → Lemmer 1188
hsvdebilt.mijnhengelsportvereniging.nlHSV De BiltThe website of HSV De Bilt provides information about the fishing association, with a particular focus on the fly fishing club, and offers updates, photos, and reports on fly fishing activities.Fishing → Fly Fishing 58 fly fishing 19 trophy 145 fishing 424 newsletter 6504 event 45199 De Fryske Marren → Joure 689
titani.nlGoochelaar TitaniThe website of Goochelaar Titani showcases a professional magician specializing in magic tricks with doves, entertainment for events like conferences, fairs, and trade shows, and Table-Magic performances.Magic → Magicians 96 dove 29 magic 258 entertainment 1165 performance 7586 event 45199 Heerde → Wapenveld 203
vakantiehuisjesneekermeer.nlVakantiehuisje SneekermeerThe website of Vakantiehuisje Sneekermeer presents a holiday home for rent in Goingarijp, Friesland, situated on the Sneekermeer and Goingarijpster Poelen, and provides information about the surrounding area with water and sports activities.Accommodation → Bungalow Parks 931 AccommodationTypes → Outdoors 224 sneekermeer 14 watersport 540 park 1863 holiday home 2753 boat 2980 garden 13129 De Fryske Marren → Goingarijp 86
saxumciviel.nlSaxum CivielSaxum Civiel is a civil construction company specializing in managing and delivering projects in ground, road, and water construction, with a focus on simplifying complex projects and providing straightforward solutions.Civil & Infrastructure → & Waterways 96 Civil & Infrastructure → Bridge Construction 31 complexity 53 contract 2415 De Fryske Marren → Joure 689
skipsleat.nlBuurtvereniging SkipsleatBuurtvereniging Skipsleat is an organization dedicated to fostering social and cultural connections and improving the quality of life within the Skipsleat neighborhood.Neighborhood Organizations → Residents’ Associations 965 Neighborhood Focus → Neighborhood Activities 187 quality of life 111 neighborhood association 177 neighborhood 2424 member 10154 Opsterland → Terwispel 33